DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. DIP original experiment: DIP-219763X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. DIP original experiment: DIP-219761X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. Only protein-protein interactions ecolx Escherichia coli atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. DIP original experiment: DIP-219762X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. mama_magmg Magnetosome protein MamA mamA mam22 protein protein magmg Magnetospirillum magnetotacticum Aquaspirillum magnetotacticum MSSKPSDILDEVTLYAHYGLSVAKKLGMNMVDAFRAAFSVNDDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASV DIP protein Q50224 original sequence version: 46 DIP protein Q50224 original sequence version: 53 mam22-1 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mam22-2 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mam22-mam22-1 1 4 unspecified role unspecified role prey prey magmg Magnetospirillum magnetotacticum Aquaspirillum magnetotacticum 4 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association