DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216177X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216183X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216181X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216176X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216168X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216170X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216179X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216182X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216175X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216169X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216174X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216171X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216180X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216178X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216172X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. PLoS biology 2010 imex curation Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M. DIP original experiment: DIP-216173X PLoS biology 2010 IMEx Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. iscu_eco57 Iron-sulfur cluster assembly scaffold protein IscU iscU nifU ECs3395 Z3796 Sulfur acceptor protein IscU protein protein eco57 Escherichia coli O157:H7 MAYSEKVIDHYENPRNVGSFDNNDENVGSGMVGAPACGDVMKLQIKVNDEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIADYKSKREAK DIP protein P0ACD6 original sequence version: 31 47516021442B6535 iscx_eco57 Protein IscX iscX Z3791 ECs3390 protein protein eco57 Escherichia coli O157:H7 MGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE DIP protein P0C0M0 original sequence version: 30 tusa_eco57 Sulfur carrier protein TusA tusA Sulfur mediator TusA Sulfur transfer protein TusA tRNA 2-thiouridine synthesizing protein A ECs4319 Z4844 protein protein eco57 Escherichia coli O157:H7 MTDLFSSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFMEHELVAKETDGLPYRYLIRKGG DIP protein P0A892 original sequence version: 30 thii_eco57 tRNA sulfurtransferase thiI Sulfur carrier protein ThiS sulfurtransferase Thiamine biosynthesis protein ThiI tRNA 4-thiouridine synthase ECs0477 Z0526 protein protein eco57 Escherichia coli O157:H7 MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNIEVRAKDENQRLTIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLDGKTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFVAINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKSPTVKAVKSKIEAEEEKFDFSILDKVVEEANNVDIREIAQQTGQEVVEVETVNDFGPNDVILDIRSVDEQEDKPLKVEGIDVVSLPFYKLSTKFGDLDQNRTWLLWCERGVMSRLQALYLREQGFKNVKVYRP DIP protein Q8XE74 original sequence version: 56 iscs_eco57 Cysteine desulfurase IscS iscS ECs3396 Z3797 protein protein eco57 Escherichia coli O157:H7 MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH DIP protein P0A6B9 original sequence version: 34 1E4F2E6F9CD266B0 cyay_eco57 Iron-sulfur cluster assembly protein CyaY cyaY Z5323 ECs4738 protein protein eco57 Escherichia coli O157:H7 MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFRDLLEQAATQQAGETVSFR DIP protein Q8XAP0 original sequence version: 47 iscs-tusa-4 16 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction iscs-tusa-5 5 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction iscx-iscs-1 2 18 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli association association cyay-iscs-3 7 22 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey P0A6B9:p.[Arg237Glu;Met239Glu] R237E/M239E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R237E/M239E'. Wed May 02 15:49:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg237glu,met239glu' Tue Jun 30 17:36:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg237Glu;Met239Glu]' P0A6B9:p.[Arg225Glu;Glu227Arg] R225E/E227R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R225E/E227R'. Wed May 02 18:14:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg225glu,glu227arg' Tue Jun 30 19:49:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg225Glu;Glu227Arg]' P0A6B9:p.Arg340Glu R340E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R340E'. Wed May 02 18:07:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg340glu' Tue Jun 30 17:30:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg340Glu' P0A6B9:p.Ala327Val A327V mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A327V'. Wed May 02 16:21:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala327val' Tue Jun 30 16:49:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala327Val' P0A6B9:p.Gly234Leu G234L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G L This feature has been corrected as a result of our quality control procedures. The original label was 'G234L'. Wed May 02 19:09:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly234leu' Tue Jun 30 16:29:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly234Leu' P0A6B9:p.Arg220Glu R220E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R220E'. Wed May 02 19:16:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg220glu' Tue Jun 30 20:19:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg220Glu' P0A6B9:p.Arg223Glu R223E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R223E'. Wed May 02 15:28:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg223glu' Tue Jun 30 15:51:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg223Glu' P0A6B9:p.Arg116Glu R116E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R116E'. Wed May 02 20:13:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg116glu' Tue Jun 30 18:17:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Glu' P0A6B9:p.Arg39Glu R39E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R39E'. Wed May 02 17:56:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg39glu' Tue Jun 30 15:36:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg39Glu' ecolx Escherichia coli physical association physical association thii-iscs-1 1 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey P0A6B9:p.Ala327Val A327V mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A327V'. Wed May 02 16:45:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala327val' Tue Jun 30 18:52:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala327Val' P0A6B9:p.Glu311Arg E311R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E311R'. Wed May 02 15:43:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu311arg' Tue Jun 30 18:40:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu311Arg' P0A6B9:p.Arg223Glu R223E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R223E'. Wed May 02 16:58:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg223glu' Tue Jun 30 16:50:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg223Glu' P0A6B9:p.Arg116Glu R116E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R116E'. Wed May 02 18:02:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg116glu' Tue Jun 30 19:34:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Glu' P0A6B9:p.Phe89Glu F89E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F89E'. Wed May 02 19:52:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe89glu' Tue Jun 30 17:24:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe89Glu' P0A6B9:p.Trp45Arg W45R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W R This feature has been corrected as a result of our quality control procedures. The original label was 'W45R'. Wed May 02 16:24:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp45arg' Tue Jun 30 19:39:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp45Arg' P0A6B9:p.Arg220Glu R220E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R220E'. Wed May 02 16:25:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg220glu' Tue Jun 30 19:08:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg220Glu' P0A6B9:p.[Arg237Glu;Met239Glu] R237E/M239E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R237E/M239E'. Wed May 02 18:30:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg237glu,met239glu' Tue Jun 30 17:27:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg237Glu;Met239Glu]' P0A6B9:p.Arg340Glu R340E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R340E'. Wed May 02 17:29:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg340glu' Tue Jun 30 18:13:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg340Glu' ecolx Escherichia coli physical association physical association iscs-tusa-6 10 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cyay-iscs-4 8 22 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli association association iscs-iscu-6 11 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tusa-iscs-1 9 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey P0A6B9:p.Trp45Arg W45R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W R This feature has been corrected as a result of our quality control procedures. The original label was 'W45R'. Wed May 02 19:48:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp45arg' Tue Jun 30 15:41:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp45Arg' P0A6B9:p.Glu49Ala E49A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E49A'. Wed May 02 19:11:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu49ala' Tue Jun 30 15:35:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu49Ala' P0A6B9:p.Asp52Arg D52R/Y/M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D R Wed May 02 18:58:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp52arg' Tue Jun 30 16:02:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp52Arg' P0A6B9:p.Arg340Glu R340E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R340E'. Wed May 02 16:03:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg340glu' Tue Jun 30 20:22:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg340Glu' P0A6B9:p.Asp65Phe D65F mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D F This feature has been corrected as a result of our quality control procedures. The original label was 'D65F'. Wed May 02 19:12:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp65phe' Tue Jun 30 16:08:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp65Phe' P0A6B9:p.Asp52Tyr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D Y Wed May 02 14:26:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp52tyr' Tue Jun 30 18:16:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp52Tyr' P0A6B9:p.Asp52Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D M Wed May 02 16:29:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp52met' Tue Jun 30 16:12:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp52Met' ecolx Escherichia coli physical association physical association iscs-iscu-7 6 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tusa-iscs-2 3 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0A892:p.Glu21Ala E21A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E21A'. Wed May 02 20:31:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu21ala' Tue Jun 30 17:43:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu21Ala' P0A892:p.Met24Arg M24R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M R This feature has been corrected as a result of our quality control procedures. The original label was 'M24R'. Wed May 02 19:02:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met24arg' Tue Jun 30 20:10:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met24Arg' P0A892:p.Arg27Glu R27E/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 15:43:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg27glu' Tue Jun 30 18:24:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg27Glu' P0A892:p.Arg31Ala R31A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R31A'. Wed May 02 14:53:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg31ala' Tue Jun 30 15:45:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg31Ala' P0A892:p.Phe58Ala F58A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F58A'. Wed May 02 15:01:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe58ala' Tue Jun 30 19:47:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe58Ala' P0A892:p.Arg27Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R D Wed May 02 14:44:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg27asp' Tue Jun 30 17:11:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg27Asp' ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association iscs-iscu-8 12 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction iscs-1 13 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction iscx-iscs-2 14 18 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey P0A6B9:p.Ala327Val A327V mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A327V'. Wed May 02 17:07:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala327val' Tue Jun 30 17:07:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala327Val' P0A6B9:p.Gly234Leu G234L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G L This feature has been corrected as a result of our quality control procedures. The original label was 'G234L'. Wed May 02 19:11:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly234leu' Tue Jun 30 19:19:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly234Leu' P0A6B9:p.Arg223Glu R223E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R223E'. Wed May 02 15:14:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg223glu' Tue Jun 30 17:58:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg223Glu' P0A6B9:p.Arg116Glu R116E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R116E'. Wed May 02 15:41:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg116glu' Tue Jun 30 20:22:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Glu' P0A6B9:p.Arg112Glu R112E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R112E'. Wed May 02 18:21:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg112glu' Tue Jun 30 18:04:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg112Glu' P0A6B9:p.[Arg225Glu;Glu227Arg] R225E/E227R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R225E/E227R'. Wed May 02 19:40:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg225glu,glu227arg' Tue Jun 30 17:59:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg225Glu;Glu227Arg]' P0A6B9:p.Arg220Glu R220E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R220E'. Wed May 02 17:49:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg220glu' Tue Jun 30 19:09:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg220Glu' P0A6B9:p.[Arg237Glu;Met239Glu] R237E/M239E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R237E/M239E'. Wed May 02 17:29:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg237glu,met239glu' Tue Jun 30 16:33:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg237Glu;Met239Glu]' P0A6B9:p.Arg340Glu R340E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R340E'. Wed May 02 14:46:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg340glu' Tue Jun 30 16:18:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg340Glu' P0A6B9:p.[Arg223Glu;Arg225Glu] R223E/R225E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R223E/R225E'. Wed May 02 15:53:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg223glu,arg225glu' Tue Jun 30 20:14:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg223Glu;Arg225Glu]' ecolx Escherichia coli physical association physical association iscu-iscs-2 15 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0ACD6:p.Lys103Glu K103E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K103E'. Wed May 02 15:21:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys103glu' Tue Jun 30 19:42:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys103Glu' N-terminal domain Region 1-12 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association iscu-iscs-4 4 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey P0A6B9:p.Ala327Val A327V mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V This feature has been corrected as a result of our quality control procedures. The original label was 'A327V'. Wed May 02 14:47:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala327val' Tue Jun 30 16:24:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala327Val' ecolx Escherichia coli physical association physical association