DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and functional analysis of the YAP-binding domain of human TEAD2. Structural and functional analysis of the YAP-binding domain of human TEAD2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Tian W., Yu J., Tomchick DR., Pan D., Luo X. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Tian W., Yu J., Tomchick DR., Pan D., Luo X. DIP original experiment: DIP-219704X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the YAP-binding domain of human TEAD2. Structural and functional analysis of the YAP-binding domain of human TEAD2. Structural and functional analysis of the YAP-binding domain of human TEAD2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Tian W., Yu J., Tomchick DR., Pan D., Luo X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tian W., Yu J., Tomchick DR., Pan D., Luo X. DIP original experiment: DIP-219707X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the YAP-binding domain of human TEAD2. Structural and functional analysis of the YAP-binding domain of human TEAD2. Structural and functional analysis of the YAP-binding domain of human TEAD2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Tian W., Yu J., Tomchick DR., Pan D., Luo X. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Tian W., Yu J., Tomchick DR., Pan D., Luo X. DIP original experiment: DIP-219706X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the YAP-binding domain of human TEAD2. Structural and functional analysis of the YAP-binding domain of human TEAD2. Structural and functional analysis of the YAP-binding domain of human TEAD2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Tian W., Yu J., Tomchick DR., Pan D., Luo X. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Tian W., Yu J., Tomchick DR., Pan D., Luo X. DIP original experiment: DIP-219705X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the YAP-binding domain of human TEAD2. tead2_human Transcriptional enhancer factor TEF-4 TEAD2 TEA domain family member 2 TEF4 protein protein human Homo sapiens Human MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRD DIP protein Q15562 original sequence version: 97 DIP protein Q15562 original sequence version: 135 A9077F55638A3AC7 yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL DIP protein P46937 original sequence version: 143 DIP protein P46937 original sequence version: 98 DIP protein P46937-1 original sequence version: 110 DIP protein P46937 original sequence version: 149 DIP protein P46937 original sequence version: 153 DIP protein P46937 original sequence version: 157 DIP protein P46937 original sequence version: 160 DIP protein P46937 original sequence version: 122 DIP protein P46937 original sequence version: 124 6145F7049ED338AE tead2-yap1-1 3 5 unspecified role unspecified role unspecified role unspecified role YBD domain Region 217-447 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 61-100 Region 61-100 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction tead2-yap1-2 1 5 unspecified role unspecified role unspecified role unspecified role YBD domain Region 217-447 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role TBD domain Region 2-268 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction yap1-tead2-1 2 5 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q15562:p.Tyr442His Y442H mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y H This feature has been corrected as a result of our quality control procedures. The original label was 'Y442H'. Wed May 02 16:53:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr442his' Tue Jun 30 17:30:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr442His' Q15562:p.Leu444Ala L444A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L444A'. Wed May 02 17:45:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu444ala' Tue Jun 30 17:16:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu444Ala' Q15562:p.His440Ala H440A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H440A'. Wed May 02 18:54:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his440ala' Tue Jun 30 18:25:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His440Ala' Q15562:p.[Val427Ala;Glu429Lys] V427A/E429K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V427A/E429K'. Wed May 02 19:49:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val427ala,glu429lys' Tue Jun 30 15:58:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val427Ala;Glu429Lys]' Q15562:p.[Glu404Lys;Asn405Ala] E404K/N405A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E404K/N405A'. Wed May 02 16:27:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu404lys,asn405ala' Tue Jun 30 17:05:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu404Lys;Asn405Ala]' Q15562:p.Val402Ala V402A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V402A'. Wed May 02 18:03:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val402ala' Tue Jun 30 16:15:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val402Ala' Q15562:p.Leu393Ala L393A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L393A'. Wed May 02 18:02:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu393ala' Tue Jun 30 18:54:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu393Ala' Q15562:p.Phe386Ala F386A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F386A'. Wed May 02 14:56:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe386ala' Tue Jun 30 16:12:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe386Ala' Q15562:p.Tyr382Ala Y382A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y382A'. Wed May 02 16:49:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr382ala' Tue Jun 30 19:25:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr382Ala' Q15562:p.Pro378Ala P378A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P378A'. Wed May 02 20:31:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro378ala' Tue Jun 30 17:19:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro378Ala' Q15562:p.Ser377Ala S377A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S377A'. Wed May 02 16:44:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser377ala' Tue Jun 30 16:17:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser377Ala' Q15562:p.Glu359Lys E359K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E359K'. Wed May 02 19:25:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu359lys' Tue Jun 30 16:33:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu359Lys' Q15562:p.[Glu356Arg;Lys357Glu] E356R/K357E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E356R/K357E'. Wed May 02 15:51:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu356arg,lys357glu' Tue Jun 30 19:06:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu356Arg;Lys357Glu]' Q15562:p.Trp303Ala W303A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W303A'. Wed May 02 20:18:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp303ala' Tue Jun 30 19:11:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp303Ala' Q15562:p.[Leu299Ala;Lys301Glu] L299A/K301E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L299A/K301E'. Wed May 02 20:20:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu299ala,lys301glu' Tue Jun 30 16:19:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu299Ala;Lys301Glu]' Q15562:p.Lys277Glu K277E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K277E'. Wed May 02 14:41:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys277glu' Tue Jun 30 18:09:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys277Glu' Q15562:p.Ile274Ala I274A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I274A'. Wed May 02 18:12:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile274ala' Tue Jun 30 18:50:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile274Ala' Q15562:p.Val269Ala V269A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V269A'. Wed May 02 19:44:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val269ala' Tue Jun 30 18:35:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val269Ala' Q15562:p.Glu267Arg E267R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E267R'. Wed May 02 17:08:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu267arg' Tue Jun 30 18:29:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu267Arg' in vitro In vitro 6 unspecified role unspecified role bait bait TBD domain Region 2-268 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction tead2-yap1-3 4 5 unspecified role unspecified role unspecified role unspecified role YBD domain Region 217-447 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role TBD domain Region 2-268 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction