DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216245X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216254X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216264X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216252X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216272X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216256X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216246X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216273X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216244X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down anti tag western anti tag western blot anti tag western Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216260X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216270X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216259X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216262X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216263X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216253X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216269X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216257X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216258X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216261X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216247X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216255X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216248X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216249X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216243X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216266X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216265X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216250X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216271X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216241X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216267X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216242X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216251X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. NINJA connects the co-repressor TOPLESS to jasmonate signalling. Nature 2010 imex curation Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down predetermined predetermined participant predetermined Pauwels L., Barbero GF., Geerinck J., Tilleman S., Grunewald W., Pérez AC., Chico JM., Bossche RV., Sewell J., Gil E., García-Casado G., Witters E., Inzé D., Long JA., De Jaeger G., Solano R., Goossens A. DIP original experiment: DIP-216268X Nature 2010 IMEx NINJA connects the co-repressor TOPLESS to jasmonate signalling. tpl_arath Protein TOPLESS TPL WSIP1 WUS-interacting protein 1 F7H2.9 At1g15750 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQPTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNASLDYPSADSEHVSKRTRPMGISDEVNLGVNMLPMSFSGQAHGHSPAFKAPDDLPKTVARTLSQGSSPMSMDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSVNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSLGVVQFDTTKNRYLAAGDDFSIKFWDMDAVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSGNENVIKIMANSDGLRLLHTFENISSESSKPAINSIAAAAAAAATSAGHADRSANVVSIQGMNGDSRNMVDVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRLIFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQRSKVLPLPQGRPNSAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWAVRESLAPITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQEPNMFAVGLSDGGVHIFEPLESEGKWGVAPPAENGSASGAPTAPSVGASASDQPQR DIP protein Q94AI7 original sequence version: 64 6211EE51BC309299 afp2_arath Ninja-family protein AFP2 AFP2 ABI five-binding protein 2 F21F23.17 At1g13740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGEASRQQRAWNREMTVTTNLSLDIDKYPRDLLRGFMSENGGGRVFHGGETNCDDESTIELNLGLSLGGRFGVDKTPRKLKRSSSVLDTVPFNDSTVAEPENYTVGLERTTSLPAEMEEEWRKRKEMQSLRRMEAKRRRCEKQSFRVGNSDDQTVSFENERWVTASKSGFLQRHLVSSNRQVCGVDSDGGGATGGGSSSSLSELDNKNQQGSSNSCNDERSPKIVAGCSSNSGSQGTERPSVTRANKVNENENEKRVRSEDSVDRKGKGMATSTGLVDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVNTSSSTF DIP protein Q9LMX5 original sequence version: 39 0C7EEC22647A47D7 tif3b_arath Protein TIFY 3B TIFY3B JAZ12 Jasmonate ZIM domain-containing protein 12 F22D1.70 At5g20900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTKVKDEPRASVEGGCGVADGDGGAAEIGGTGSVEKSINEVRSTEIQTAEPTVPPNQLTIFFGGSVTVFDGLPSEKVQEILRIAAKAMETKNSTSISPVSSPALNRAPSFSSTSNVASPAAQPFPIQPISFCRSTADLPIARRHSLQRFLEKRRDRLVNKNPYPTSDFKKTDVPTGNVSIKEEFPTA DIP protein Q9C5K8 original sequence version: 48 DIP protein Q9C5K8 original sequence version: 86 4F0C66DECBB4F0E1 tif3a_arath Protein TIFY 3A TIFY3A JAZ11 Jasmonate ZIM domain-containing protein 11 T18D12.10 At3g43440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEVNGDFPVPSFADGTGSVSAGLDLLVERSIHEARSTEPDASTQLTIIFGGSCRVFNGVPAQKVQEIIRIAFAGKQTKNVTGINPALNRALSFSTVADLPIARRRSLQRFLEKRRDRSTKPDGSMILPSQLTIIFGGSFSVFDGIPAEKVQEILHIAAAAKATETINLTSINPALKRAISFSNASTVACVSTADVPIARRRSLQRFFEKRRHRFVHTKPYSATTSEADKNETSPIVT DIP protein Q9M246 original sequence version: 49 DIP protein Q9M246 original sequence version: 85 841F602E9BE9EE9E afp3_arath Ninja-family protein AFP3 At3g29575 ABI five-binding protein 3 MWE13.5 AFP3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKKQRLSEEDGEVEIELDLGLSLNGRFGVDPLAKTRLMRSTSVLDLVVNDRSGLSRTCSLPVETEEEWRKRKELQSLRRLEAKRKRSEKQRKHKACGGEEKVVEEGSIGSSGSGSSGLSEVDTLLPPVQATTNKSVETSPSSAQSQPENLGKEASQNIIEDMPFVSTTGDGPNGKKINGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPSPFL DIP protein Q94F39 original sequence version: 36 7CE5267AC501012D myc3_arath Transcription factor MYC3 MYC3 ATR2 BHLH5 EN36 Basic helix-loop-helix protein 5 Protein ALTERED TRYPTOPHAN REGULATION 2 Transcription factor ATR2 Transcription factor EN 36 bHLH transcription factor bHLH005 MZA15.18 At5g46760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNGTTSSINFLTSDDDASAAAMEAFIGTNHHSSLFPPPPQQPPQPQFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEEDKEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNGVGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEVISQSSDLMHKVNNLFNFNNGGGNNGVEASSWGFNLNPDQGENDPALWISEPTNTGIESPARVNNGNNSNSNSKSDSHQISKLEKNDISSVENQNRQSSCLVEKDLTFQGGLLKSNETLSFCGNESSKKRTSVSKGSNNDEGMLSFSTVVRSAANDSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGCGSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKVALMTKVGENY DIP protein Q9FIP9 original sequence version: 49 DIP protein Q9FIP9 original sequence version: 93 tpr2_arath Topless-related protein 2 TPR2 K20I9.6 At3g16830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSLSRELVFLILQFLDEEKFKESVHKLEQESGFFFNIKYFEEKALAGEWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRNDRAKAVEILAKDLKVFATFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMYTELKKLIEANPLFREKLAFPSFKASRLRTLINQSLNWQHQLCKNPRPNPDIKTLFLDHSCSPSNGARALTPVNLPVAAVARPSNFVPLGVHGGPFQSNPAPAPNANALAGWMANPNPSSSVPSGVVAASPFPMQPSQVNELKHPRAPSNSLGLMDYQSADHEQLMKRLRSAQTSNEVTYPAHSHPPASLDDLPRNVVSTIRQGSVVISMDFHPSHHTLLAVGCSSGEVTLWEVGSREKVVTEPFKIWNMAACSVIFQGSIVKEPSISVTRVAWSPDGNLLGVSFTKHLIHVYAYQGSDLRQHLEIDAHVGCVNDLAFAHPNKQMCVVTCGDDKLIKVWDLSGKKLFTFEGHEAPVYSICPHQKENIQFIFSTALDGKIKAWLYDNVGSRVDYDAPGQWCTTMLYSADGSRLFSCGTSKEGDSFLVEWNESEGALKRTYLGFRKKSAGVVQFDTTRNRFLAVGEDNQIKFWNMDNTNLLTVVEAEGGLPNLPRLRFNKDGNLLAVTTADNGFKILANTDGLRTLRAFEARSFEASKASIDMKVSTSAMASSISPAIGKIEHMDAGSPARPTPIPNGIEAMSRTMEKPRNLDSVDKSKPLELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRLWKWIRNEQNPTGKATASVTPQHWQPNSGLLMANDVPENPEGSVPCIALSKNDSYVMSACGGKVSLFNMMTFKVMTTFMPPPPASTFLAFHPQDNNIIAIGMEDSSIHIYNVRVDEVKTKLKGHQKHITGLAFSTALNILVSSGADAQLFFWTADSWEKKKSSAIQLPPGKAPVGDTRVQFHNDQIQLLVSHETQLAIYDASKMECIHKWVPQEALSSPITSASYSCNSQLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPNSAPIFPQVITAHPQEPNQLAVGLSDGSVKVIEPSELSRRWGVGVAAGSDKAGTENGRPSSSSAANNSSSDQIQR DIP protein Q9LRZ0 original sequence version: 65 mint 7AB804673A5359F4 ti11b_arath Protein TIFY 11B TIFY11B JAZ6 Jasmonate ZIM domain-containing protein 6 T10D10.8 At1g72450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTGQAPEKSNFSQRCSLLSRYLKEKGSFGNINMGLARKSDLELAGKFDLKGQQNVIKKVETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFFGGKVMVFNEFPEDKAKEIMEVAKEANHVAVDSKNSQSHMNLDKSNVVIPDLNEPTSSGNNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL DIP protein Q9C9E3 original sequence version: 44 DIP protein Q9C9E3 original sequence version: 70 DIP protein Q9C9E3 original sequence version: 78 E67821C53F6B138F tif6a_arath Protein TIFY 6A TIFY6A JAZ4 Jasmonate ZIM domain-containing protein 4 T1N15.11 At1g48500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKLSPITVKEETNEDSAPSRGMMDWSFSSKVGSGPQFLSFGTSQQETRVNTVNDHLLSSAAMDQNQRTYFSSLQEDRVFPGSSQQDQTTITVSMSEPNYINSFINHQHLGGSPIMAPPVSVFPAPTTIRSSSKPLPPQLTIFYAGSVLVYQDIAPEKAQAIMLLAGNGPHAKPVSQPKPQKLVHHSLPTTDPPTMPPSFLPSISYIVSETRSSGSNGVTGLGPTKTKASLASTRNNQTAAFSMAPTVGLPQTRKASLARFLEKRKERVINVSPYYVDNKSSIDCRTLMSECVSCPPAHHLH DIP protein Q58G47 original sequence version: 31 DIP protein Q58G47 original sequence version: 58 DIP protein Q58G47 original sequence version: 68 83E08ACF3E387ADC ppd1_arath PsbP domain-containing protein 1, chloroplastic PPD1 At4g15510 OEC23-like protein 3 PsbP-related thylakoid lumenal protein 1 FCAALL.88 dl3795w protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSAFAFPSYIITKGASTDSFKSTSLSSSRSLVTDFHLLFSRPISSGPKYQSAKSAKPESPVAINCLTDAKQVCAVGRRKSMMMGLLMSGLIVSQANLPTAFASTPVFREYIDTFDGYSFKYPQNWIQVRGAGADIFFRDPVVLDENLSVEFSSPSSSNYTSLEDLGSPEEVGKRVLRQYLTEFMSTRLGVKRQANILSTSSRVADDGKLYYQVEVNIKSYANNNELAVMPQDRVARLEWNRRYLAVLGVENDRLYSIRLQTPEKVFLEEEKDLRRVMDSFRVEKI DIP protein O23403 original sequence version: 77 tif4b_arath Protein TIFY 4B TIFY4B PPD2 Protein PEAPOD 2 FCAALL.297 dl3400c At4g14720 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDVGVTTAKSILEKPLKLLTEEDISQLTREDCRKFLKEKGMRRPSWNKSQAIQQVLSLKALYEPGDDSGAGILRKILVSQPPNPPRVTTTLIEPRNELEACGRIPLQEDDGACHRRDSPRSAEFSGSSGQFVADKDSHKTVSVSPRSPAETNAVVGQMTIFYSGKVNVYDGVPPEKARSIMHFAANPIDLPENGIFASSRMISKPMSKEKMVELPQYGLEKAPASRDSDVEGQANRKVSLQRYLEKRKDRRFSKTKKAPGVASSSLEMFLNRQPRMNAAYSQNLSGTGHCESPENQTKSPNISVDLNSDLNSEDN DIP protein Q8GY55 original sequence version: 38 C971E8E95FA29211 ti11a_arath Protein TIFY 11A TIFY11A JAZ5 Jasmonate ZIM domain-containing protein 5 F1L3.3 F28G4.16 At1g17380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSNENAKAQAPEKSDFTRRCSLLSRYLKEKGSFGNIDLGLYRKPDSSLALPGKFDPPGKQNAMHKAGHSKGEPSTSSGGKVKDVADLSESQPGSSQLTIFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINIQTPINDENNNNKSSMVLPDLNEPTDNNHLTKEQQQQQEQNQIVERIARRASLHRFFAKRKDRAVARAPYQVNQNAGHHRYPPKPEIVTGQPLEAGQSSQRPPDNAIGQTMAHIKSDGDKDDIMKIEEGQSSKDLDLRL DIP protein Q9LDU5 original sequence version: 50 DIP protein Q9LDU5 original sequence version: 78 DIP protein Q9LDU5 original sequence version: 87 54A55E02C18E5BAF tif9_arath Protein TIFY 9 TIFY9 JAS1 JAZ10 Protein JASMONATE-ASSOCIATED 1 Jasmonate ZIM domain-containing protein 10 Protein JAZ10 T31B5.40 At5g13220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKATIELDFLGLEKKQTNNAPKPKFQKFLDRRRSFRDIQGAISKIDPEIIKSLLASTGNNSDSSAKSRSVPSTPREDQPQIPISPVHASLARSSTELVSGTVPMTIFYNGSVSVFQVSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQNLEGDLPIARRKSLQRFLEKRKERLVSTSPYYPTSA DIP protein Q93ZM9 original sequence version: 44 DIP protein Q93ZM9 original sequence version: 70 DIP protein Q93ZM9 original sequence version: 79 475DADBCEDC540E1 tif7_arath Protein TIFY 7 TIFY7 JAZ9 F5A18.12 At1g70700 Jasmonate ZIM domain-containing protein 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLSDKQYLSNNVKHEVNDDAVEERGLSTKAAREWGKSKVFATSSFMPSSDFQEAKAFPGAYQWGSVSAANVFRRCQFGGAFQNATPLLLGGSVPLPTHPSLVPRVASSGSSPQLTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPYKKMLLDLSTGESSGMNYSSTSPT DIP protein Q8W4J8 original sequence version: 38 DIP protein Q8W4J8 original sequence version: 58 DIP protein Q8W4J8-1 original sequence version: 59 DIP protein Q8W4J8 original sequence version: 68 DIP protein Q8W4J8-1 original sequence version: 78 855ACCF25C47B650 tif6b_arath Protein TIFY 6B TIFY6B JAI3 JAZ3 MEB5.8 At3g17860 Jasmonate ZIM domain-containing protein 3 Protein JASMONATE INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRHRKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQSHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT DIP protein Q9LVI4 original sequence version: 75 DIP protein Q9LVI4 original sequence version: 51 DIP protein Q9LVI4 original sequence version: 72 DIP protein Q9LVI4 original sequence version: 81 DIP protein Q9LVI4 original sequence version: 91 D65DEEA2F04C58E4 tif5a_arath Protein TIFY 5A TIFY5A JAZ8 Jasmonate ZIM domain-containing protein 8 T2H7 At1g30135 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLQQNCDLELRLFPTSYDSDSSDTTSVVESTSSGNPQPNEESQRITIFYNGKMCFSSDVTHLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKASMKKSLQSFLQKRKIRIQATSPYHSRR DIP protein Q8LBM2 original sequence version: 35 DIP protein Q8LBM2 original sequence version: 62 DIP protein Q8LBM2 original sequence version: 71 4C4F6E24842E5B2B ninja_arath AFP homolog 2 NINJA At4g28910 AFPH2 F25O24.30 Novel interactor of JAZ protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDDDNGLELSLGLSCGGSTGKAKGNNNNNAGSSSENYRAEGGDRSAKVIDDFKNFLHPTSQRPAEPSSGSQRSDSGQQPPQNFFNDLSKAPTTEAEASTKPLWVEDESRKEAGNKRKFGFPGMNDDKKKEKDSSHVDMHEKKTKASHVSTATDEGSTAENEDVAESEVGGGSSSNHAKEVVRPPTDTNIVDNLTGQRRSNHGGSGTEEFTMRNMSYTVPFTVHPQNVVTSMPYSLPTKESGQHAAATSLLQPNANAGNLPIMFGYSPVQLPMLDKDGSGGIVALSQSPFAGRVPSNSATAKGEGKQPVAEEGSSEDASERPTGDNSNLNTAFSFDFSAIKPGMAADVKFGGSGARPNLPWVSTTGSGPHGRTISGVTYRYNANQIKIVCACHGSHMSPEEFVRHASEEYVSPESSMGMTAASAHT DIP protein Q9SV55 original sequence version: 44 1796FB2FAAB0FB89 coi1_arath Coronatine-insensitive protein 1 FBL2 At2g39940 COI1 COI-1 F-box/LRR-repeat protein 2 T28M21.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYWNIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLAGQRTDCPTTVRVLKEPI DIP protein O04197 original sequence version: 103 DIP protein O04197 original sequence version: 98 DIP protein O04197 original sequence version: 80 DIP protein O04197 original sequence version: 84 DIP protein O04197 original sequence version: 101 DIP protein O04197 original sequence version: 119 1DDCF04990144C06 tpr3_arath Topless-related protein 3 TPR3 F15P11.3 F2P16.14 At5g27030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSLSRELVFLILQFLEEEKFKESVHRLEKESGFFFNTKYFDEKVLAGEWDDVETYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRQEKAKAVEILVQDLRVFSTFNEELYKEITQLLTLQNFRENEQLSKYGDTKTARGIMLGELKKLIEANPLFRDKLMFPTLRSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHTCTLPNGPLAPSAVNQPVTTLTKPAAYPSLGPHVPFPPGPAAANAGALASWMAAASGASAVQAAVVTPALMPQPQNQMSILKRPRTPPATPGIVDYQNPDHELMKRLRPAPSVEEVTYPAPRQQAPWSLEDLPTKAALALHQGSTVTSMEFYPMQNTLLLVGSATGEITLWELAARERLVSRPFKIWDMSNCSHQFQALIAKETPISVTRVAWSPDGNFIGVAFTKHLIQLYAFSGPNDLRQHTEIDAHVGAVNDLAFANPNRQLCVITCGDDKLIKVWDVSGRKHFTFEGHDAPVYSICPHYKENIQFIFSTAIDGKIKAWLYDNLGSRVDYDAPGKWCTRMLYSADGTRLFSCGTSKDGDSFLVEWNESEGSIKRTYKEFQKKLAGVVQFDTSKNHFLAVGEDGQIKFWDMNNINVLTSTDAEGGLPALPHLRFNKDGNLLAVTTADNGFKILANPAGFRSLRAMETPASETMRTPVDFKAVPGAPVASVNCKVERGSPVRHSQMLNGVDPSKSRIDDSTDKPKSWQLAEILDPSQCFQATLPDTAGSSTKVVQLLYTNSGAGILALGSNGIQRLWKWVPNEQNPSGKATATVVPQHWQPNSGLLMTNDVSGVNLENAAPCIALSKNDSYVMSAAGGKVSLFNMMTFKVMTTFMPPPPASTFLAFHPQDNNVIAIGMEDSTIHIYNVRVDEVKSKLKGHQKRITGLAFSTALNILVSSGADAQICFWSIDTWEKRKSVAIQMPAGKAANGDTRVQFHVDQLRILVVHETQLAVFDASKMECIRQWIPQDSLSAPISSAVYACNSQLIYTTFRDGNIGVFDADSLRLRCRISPSAYLPQGNQGLSPLVVAAHPQDPNQFAVGLNDGSVKMMEPTEGEGKWGMIPPSEAINSPSTTSNQTPEQLQR DIP protein Q84JM4 original sequence version: 59 8E9AF285707FBBA9 ti10b_arath Protein TIFY 10B TIFY10B JAZ2 F9E10.20 F25A4.8 At1g74950 Jasmonate ZIM domain-containing protein 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSFSAECWDFSGRKPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQPTMMNLFPCEASGMDSSAGQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASSKPTNPAWLSSR DIP protein Q9S7M2 original sequence version: 51 DIP protein Q9S7M2 original sequence version: 81 DIP protein Q9S7M2 original sequence version: 90 7410B2A50505A543 ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI DIP protein Q9LMA8 original sequence version: 76 DIP protein Q9LMA8 original sequence version: 72 DIP protein Q9LMA8 original sequence version: 51 DIP protein Q9LMA8 original sequence version: 57 DIP protein Q9LMA8 original sequence version: 74 DIP protein Q9LMA8 original sequence version: 81 DIP protein Q9LMA8 original sequence version: 92 EF2DAAC0CEF2DBBB tif8_arath Protein TIFY 8 TIFY8 F4D11.230 At4g32570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMVNHNNGQRPTDIDSRLRQTEQDKLLFHDFLGSKNPTLASTSMADHRLPPDNKAAKAAMTPSTASASSAGGLGGLSSTSDLVERHSGGGNHLDGIQLFGPRSDVSGSIMSNRFSGNKRSNSDSHFTTQEHPETLHWSKLLRNGPGSFSMNVNPLANQPPRGGGQISHLLHQLSTSRFKDENVGPSVIAQTAADEGSRTGMKGPGILSSFTMPNSSKLESFAPSNTGNRKDLASSTKQMTIFYGGQAHVFDDVHPNKADVIMALAGSSGGSWSTGLSHKPKSKNNTSDGPYKLGQMYEGGSSKETPQMPPEFRARPSHQPTSSACHRIFTQPGREHQGSIISRGRDIRDPVHRSDPEKEAT DIP protein Q84MB2 original sequence version: 32 BEDEEA8F53DE8649 tify3b-afph2-1 12 36 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify10b-afph2-1 29 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 53 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction afph2-tpl-1 22 34 unspecified role unspecified role unspecified role unspecified role N-terminal fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 50 unspecified role unspecified role unspecified role unspecified role C-terminal fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction tify7-afph2-1 30 47 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify10a-afph2-1 10 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 54 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify6b-afph2-1 31 48 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify3a-afph2-1 18 37 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify10a-afph2-2 24 51 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 39 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 36 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 54 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress association association afph2-tpl-2 23 34 unspecified role unspecified role unspecified role unspecified role C-terminal fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 50 unspecified role unspecified role unspecified role unspecified role N-terminal fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction tify5a-afph2-1 25 49 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association afp3-tpl-1 11 38 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tpl-tpl-1 27 34 unspecified role unspecified role unspecified role unspecified role C-terminal fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 34 unspecified role unspecified role unspecified role unspecified role N-terminal fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana direct interaction direct interaction afp2-tpl-1 16 35 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify6b-afph2-2 13 48 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range N-terminal domain Region 1-208 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify6b-afph2-3 4 48 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify10a-afph2-3 9 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 54 unspecified role unspecified role bait bait Tify domain Region 116-155 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify9-afph2-1 33 46 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify10b-afph2-2 32 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 53 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify10b-afph2-3 19 53 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify6a-afph2-1 14 42 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify6a-afph2-2 15 42 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction afph2-tify10a-1 1 50 unspecified role unspecified role bait bait C-domain Region 322-425 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 54 unspecified role unspecified role prey prey Tify domain Region 116-155 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify4b-afph2-1 5 44 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ppd1-afph2-1 28 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction afph2-tpl-3 7 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role bait bait A-domain Region 1-93 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify11a-afph2-1 2 45 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify7-afph2-2 6 47 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify11b-afph2-1 26 41 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association afph2-myc3-1 20 40 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 44 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 52 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 34 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 39 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 36 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress association association tify11b-afph2-2 21 41 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify9-afph2-2 17 46 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tify11a-afph2-2 3 45 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 50 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify8-afph2-1 8 55 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction