DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Nature structural & molecular biology 2010 imex curation Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217063X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Nature structural & molecular biology 2010 imex curation Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217067X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Nature structural & molecular biology 2010 imex curation Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217061X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Nature structural & molecular biology 2010 imex curation Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217068X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Nature structural & molecular biology 2010 imex curation Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217065X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Nature structural & molecular biology 2010 imex curation Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217064X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Nature structural & molecular biology 2010 imex curation Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217062X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Nature structural & molecular biology 2010 imex curation Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217066X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. caza1_chick F-actin-capping protein subunit alpha-1 CAPZA1 CapZ 36/32 Beta-actinin subunit I protein protein chick Gallus gallus (Chicken) Chicken MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQWRDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA DIP protein P13127 original sequence version: 78 DIP protein P13127 original sequence version: 81 187E7C51541665DE q5vzk9-1 F-actin-uncapping protein LRRC16A CARMIL1 CARMIL LRRC16 LRRC16A CARMIL homolog Capping protein regulator and myosin 1 linker protein 1 Capping protein, Arp2/3 and myosin-I linker homolog 1 Capping protein, Arp2/3 and myosin-I linker protein 1 Leucine-rich repeat-containing protein 16A CARMIL1a protein protein human Homo sapiens Human MTEESSDVPRELIESIKDVIGRKIKISVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARIPTKLELTFSYLEIHGVVCSKSAQMIVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPGLSPVRIMKKVSMEPSERLASLQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQWDVDTIYLTQDTRELNLQDFSHLDHRDLIPIIAALEYNQWFTKLSSKDLKLSTDVCEQILRVVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHTINLAGNPLEDRGVSSLSIQFAKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLVHLDLSGNVLRGDDLSHMYNFLAQPNAIVHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFFSSSLALMHINLSGTKLSPEPLKALLLGLACNHNLKGVSLDLSNCELRSGGAQVLEGCIAEIHNITSLDISDNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQDEESPLQSLSLADSKLKTEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKLRTVIWDKNNITAQGFQDIAVAMEKNYTLRFMPIPMYDASQALKTNPEKTEDALQKIENYLLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQDHLNSLRNCGGDAIQEDLKSAERLMRDAKNSKTLLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRVVDEQLKALLESMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLTVASFLSDRIVDEILDALSHCHHKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHIEDPPFPSLRQEKRSSGFISELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMGRVDEGVDEFFTKKVTKMDSKKWSTRGSESHELNEGGDEKKKRDSRKSSGFLNLIKSRSKSERPPTILMTEEPSSPKGAVRSPPVDCPRKDTKAAEHNGNSERIEEIKTPDSFEESQGEEIGKVERSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPALSGVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEAGSRSRSSSSTPTSPKPLLQSPKPSLAARPVIPQKPRTASRPDDIPDSPSSPKVALLPPVLKKVPSDKERDGQSSPQPSPRTFSQEVSRRSWGQQAQEYQEQKQRSSSKDGHQGSKSNDSGEEAEKEFIFV DIP protein Q5VZK9-1 original sequence version: 87 p14315-1 F-actin-capping protein subunit beta isoforms 1 and 2 CAPZB Beta-actinin subunit II CapZ 36/32 CapZ B1 and B2 Beta-1 protein protein chick Gallus gallus (Chicken) Chicken MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN DIP protein P14315-1 original sequence version: 55 DIP protein P14315-1 original sequence version: 89 cd2ap_human CD2-associated protein CD2AP Cas ligand with multiple SH3 domains Adapter protein CMS protein protein human Homo sapiens Human MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLISKETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAPKPELIAAEKKYFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPPPPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDIASSENLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTCYSPKPSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEALKKDHGKELEKLRKDLEEEKTMRSNLEMEIEKLKKAVLSS DIP protein Q9Y5K6 original sequence version: 92 DIP protein Q9Y5K6 original sequence version: 94 DIP protein Q9Y5K6 original sequence version: 98 7576509C7ED5B343 capza1-capzb-4 5 10 unspecified role unspecified role unspecified role unspecified role CP-binding region 115 Region 964-1078 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction capza1-capzb-5 1 10 unspecified role unspecified role unspecified role unspecified role CP-binding region 52 Region 961-1012 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association capza1-capzb-6 3 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction capza1-capzb-7 2 12 unspecified role unspecified role unspecified role unspecified role CP interaction motif Region 474-506 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association capza1-capzb-8 7 10 unspecified role unspecified role unspecified role unspecified role CP-binding region 37 Region 968-1004 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association capza1-capzb-9 6 10 unspecified role unspecified role unspecified role unspecified role CP-binding region 52 Region 961-1012 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction capza1-capzb-10 8 10 unspecified role unspecified role unspecified role unspecified role CP-binding region 115 Region 964-1078 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association capza1-capzb-11 4 12 unspecified role unspecified role unspecified role unspecified role CP interaction motif Region 474-506 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction