DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216388X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216386X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216368X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216374X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216378X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216377X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216370X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216385X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216367X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216376X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216381X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216372X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216380X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216369X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216379X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions xanc8 Xanthomonas campestris pv. campestris (strain 8004) fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216382X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216384X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions xanc8 Xanthomonas campestris pv. campestris (strain 8004) fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216383X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216387X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216389X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216375X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216371X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216373X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. a0a0h2x560_xanc8 GGDEF domain-containing protein XC_0613 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MLLDDPTAALQATDRQLRQARASGQADATFWAALAQARVLISLEDSARRNQALTQARDVLGQLHGSGAQARLWLHTVQALSDVRENPNRSMVARLEELRRQARALGRRDLLCEVDAVDMWSMLASGSSDEAWNAAQASYQCAVREGSLSLELDALTQLGSLASRVGGRTAKENEAEAYLLRALARLGDLPARFQRSLIEYEYGASLALQQPDAALVHFRRALALSRALGDQAGVAAALTSASEALIETGDAAAALVTANEALPLMQAQGNIGRVAACHAVLLKAMTALTDARLGEEIAAARRADGPQLASSRRVDLADAIAAALASMGQHAQAYAELQRANALRERSQEGQRDTVMLRLQARYEDARRSAETAELRRRSETAQLALQAREAGQRTLWIALCAACLLLIAALVVVAVGWRHRRQLSTLAMRDELTGLPNRRAIRTEAQQQIEHALRTRTSCMLALIDLDHFKQINDVHGHATGDAVLKALAAASRRALRERDQLGRLGGEEFLLVLPGCTADEIGNVFARLRSAVAAIAIAGLPADAPVRFCLGAVRVTPATGLDVLLSQADLALYAAKTAGRDQWAVYGA 85E1F388A93769D7 a0a0h2x9j2_xanc8 XC_2949 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MHNGNDTRGDLVVLGPEGLYCPQGDFHIDPWRPVPRAVITHGHGDHARGGMGEYHCTRESLPILQWRLGEQVYHPHANGEAFTLGRARVSLHPAGHVLGSAQVRIEVDGQVWVASGDYKRQHDPTCAPFEVVPCDTFITEATFGLPVYRWPDTAQVAADIVAWRHECAARGEAAILYCYALGKAQRVLAELRAWDTQPALLHGAIAAGVEVYRHAGIAMLETQPVSEHARGADYAGQLVLAPPSAAGSPWIRRFRHAQQGFASGWMRIRGNRRRRNYDRGFVVSDHADWPDLLRTIADTGARRVIATHGNTDALIQHLREHGVAAEAFRTDFGAEE 05B3A24A5D48298A a0a0h2x979_xanc8 GGDEF domain-containing protein XC_2795 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MILHLRRDFRLGIVKMLGPITALLLCLYAVYLAMHGQGVACALTAALGLVAVWRGWRMRSAERTGRGGVWLASINVAGCLIGCWSGGDGALPWLFPVLATNYFLCGPQRAVLLSLPLLAALLLLPGLIVSPGQGISTVMVTLVTLAVGYAFSVRMQDDRVHLEELASLDALTGLPNRRMLERALTHQIDQRQPQDRLNSLIILDLDHFKDVNDLYGHAAGDAALADLATILRFEVREPYQVFRFGGEEFVVLLRAGSLAELEAATERLRKVIRNGLRGPGGRITVSLGAARHDGETHWQDWFSRADAALYLAKNGGRDSVRIAD 31A97C1B0637FB2F a0a0h2x5f3_xanc8 XC_0675 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MPETWMRLYAGLSRLFPRSFSAKLLAVTFVGIHLPLLLLIAWLAAQSELDGRPLWSVVIVALLATLAGTALTLSALYRLLAPLRIAADALDAYYADQRLPTLPEHGDDELGRLLRGINRSLRGIDAGMRDLKRHALFDPLTEALNRRGCEQAMRDSVTAAQREGWPFVLFVLDMDNLKPINDRFGHLAGDRVLVRLVESAYGWLGAQDWIGRWGGDEFLIGVHASEDEATLKLNQWLSMLEREDAEEAPLHVSAGSAVCEVGIDATELYRRADAAMYRAKFSGGRRLVRDGHDAPRSHPVA 64A966AAB61F2960 a0a0h2x359_xanc8 XC_0249 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MTCHTSNGAVEPTGSVAKTLSDGLHALMTAEELAFFARFGRMREIAAGQALFERGAVGTQMFIVVTGQIDLDFGEDLMLKHLGPGEFFGELGLLIGDHARSAGASASVDSRLIELAHDDFQRLVDHDPSMVAHFLRRSIVRVVNNEQLLIRQLRRRNHDLEAALDNLYVTSHQLNHTEELSRTDELTGLHNRRGLALHLQECRRGGGAPGVGLILIDCDRFKHINDEYGHLAGDRVLQNVAHALRSVIAEGDLVCRLGGDEFCVLVAQGSIELVQHMGECIVNAVQARQASSPDGCHSCSVSVGVCSIDASTSYNDWYTRADTALYQAKRQGGNSLCVYEALPLDNS 9CEA0B148B65BB0D rpfg_xanc8 Cyclic di-GMP phosphodiesterase response regulator RpfG rpfG XC_2335 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MQDVLGNPAGVSSAETWGSWSEKADLGLNIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALSWCEAGRVDLLLLDYRMPGMDGLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLLQLRQQSESVKQRALSLEQRLLASMNEVEERERETLSRLARAIEYRDGGTSAFLERMSHVAGLVAEQLGLSEEEVRIIEMAAPLHDMGKIAIPDSVLLKPGKLTEDEMNVMKRHPRIGYELLSGSQNRFIQVGALIALRHHERYDGSGYPDGLVGEAIPLEARIVAVADVFDALLSARPYKEAWTMDAALAYLYAQRGRLFDPRCVDALLRGRAQLEQICGQFSTASARPGV DIP protein Q4UU85 original sequence version: 35 a0a0h2x3k2_xanc8 GGDEF domain-containing protein XC_0420 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MAEQPEHPNRPRGGLRRLLPWGGAGTARPATLPSVLGERDGAGLAAHQLVPAKAKSGAHDPAAATALLIRLFSHAAHPEALLLAFAEGIASLHGELGDMGVRLSTAYAAGDWPGYGRALRQLIDKYIRTIDTGDSLAEGRTEAEQLRDLLRHALGNALATLLQRSPELAEEAQTLASALRHWRPGHELITLEQRLRELSHQIGLRAEDASEQQNLLLGLFDLLLENVGELLDDRSWLQGQISVVRQLIAGPMDVGSIEQARGTLREVIYKQGLLKQGIADSKTAMREMMVSFVDRLDGMATSTGEYHDRVAGYSQAIGDARSIPDLNRLLQDVLQDTAGVQAQALAARDELLSARRQVEEAEHRIASLEQELKDVAGLVREDQLTGALNRRGFEELFEREATRTQRSGQPLCVAMLDLDDFRRLNETHGHAGGDAALRHTVDVAKSVLRTTDAIARFGGEEFVLLLPDSTIFEASAAVIRLQRALAQRSLLHEDVRVFVSFSGGVAMRRTDEAQDEVIRRADRAMYDSKAAGKNRVISAD 00AC9ADBC38FE259 a0a0h2x9f2_xanc8 GGDEF domain-containing protein XC_2866 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MIFEQARELAMLRSLRELQDVAEARRHADESENRMRHLAEQASRDALTGVFNRHQLGTALAHEFELATRQAWPLSIAFIDLDDFKRVNDAHGHLVGDEVLRNFAQTLQRMVRTSDLVARYGGEEFLVILPNTTAEAALMVIERILAETARTPMAQLPGGPLHITFSAGLATHGGGDRQFESIEHLLQAADTTLYRSKHRGRNRVTAYDATEVPAQPTPRAH 1791A8E0CEB53EA5 a0a0h2x6p1_xanc8 GGDEF domain-containing protein XC_1803 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MGAPPPANEDDRLAALHSYNILDTAPEPLYDDITAAAAQLCRTPMALISLIDQDRQWFKSRVGMQPAETPRDLAFCAHAILQPDQMMEVGDTFVDPRFARNALVTGGPQIRFYAGAPLLTSDGVALGTLCVLDRAPRTLSDAERTALQALARQVVTTIELRQAARLLEGDALRDPLTDLWNREGLEHMLEDAAPVAKLHGLAFVLIEIDGFKRLKLQFGSDAADATLVQAARCIETEPQEPGGVARIGAAHFCMVLPGADSAQALASVQRLQTTIAAACWPADTISITAGLVCVAPGEPLDSHVLMARARHALLGAARAGRNCVQRFDGWQTDR DD77EDAB92ACC19C a0a0h2xar9_xanc8 XC_2793 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MLTRKAKRHAAGALMLGGLIFVLIGVGGYITSRQSLTAAAWVSHTQEVIASIDEIQAGLLSAESSARGFVLTDNEAFLGVHADAIGRLPGRIARLEVLVQDNPLQLRNVAALDKLVDMRLVQINDLLHSYRATGLDGARASIAKGVFQTSSALRRQVQLMGELERRQLVSRTQANHDSARWVLWMTAIGILSGLLVMVLAYRLLSRELARRVRAEEEASTSSTRLAESFSTLERTSAGLEALARYSGLLQNCRNAEEALEITARTIAPLVPGVSGAVYLLRASRDRAEQVAAWGTLADGERGSIAPEECWALRRDRTHLVEDASVGMVCQHAGVNLPPHASTVCIPLSAQGTQLGMLALRGDNAQELASLTVAEAAAEQLSLALHNLRLRETLRQQSIRDPLTGLFNRRYLEEALNHELSRCTRRVQPLSVLMLDVDHFKQFNDLHGHSGGDRVLAAIGELLLAQTRGEDICCRYGGEELTIILPEVDLATASAMAEKLRAGIDGLQVMADGVSLPKITASFGVATFPGHAGNAAQLLRKADEALYRAKQAGRNQVVSAVTPGSV B5ED2DF5A8360FCA a0a0h2x7k9_xanc8 XC_2274 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MPTLPALLALLLPRRGSLRARPWLPAVCMLVLALLGTAGAAHAQTFSFREYDQADGLQGMSVNGILEDRNGAVWVATETALHRFERDRFVPVGAEQGLDARYTRALTLDRAGRLWVATANGVFVRIGERFEQVHYNGKRIRADAGNVIAAYRNGVAVVSDNTLLALTPAAVTGWQVQPLPLRAADGTVLPPRRALLADGNDLWVACAATVCRLDAHGTLVEVLSDEEGVPAKRWRVIFRDRAGRLWLRGGGLIISRGPGEGRFRSHPSSAQATFNTLSGATTMVEDPQGRLLTRADHGLVRWQDGHWTAIGADQGLHLDAMVGPLLQQSTGTLWIGTRGMGIQRWLGYGSIEHLTEAQGMAAAPTWAIQRLPDGTLAVGADGGGSLLPAQAQRAQPWLQHDGQPLPQALAIAVAPDGAGWVSFFSGAIARRDPITGQTRRVMDLPSPVYKLVFDRSGTLWMATPRGIYHGSSQAPYPLAPDVALAGTFIGDLDLDAQGRLWAATADGLYRRDGNRWVQVPVHGDLPSQDLFQLDFAADGELWVSLREVGLWHGRVQPDGSVALQAVTDPLVSKVMPFILRHDRKGRLWVGSSQGLDLYQHGHWSRITRAEGLLWDDMSANAFFEDTDGSIWIGSSRGLSHLRQPERLFAAPPLRVEIAQVQRGERSLRADASVGWSETPLEIDLRTPGVEGGPERISFRYRVEGRQARWTTTSLSHITYPLLPPGNYTLEVQALDAYQRSASPIAQFAFALRPPWWRSALAIVAYVLAGIGGVVALLRWRTRKLLARKQELEHLIAERTAELEQDKRDLEAARAALTHKATHDELTGLLNRAGILEALRGMLDSAPLREQPLAVVLIDLDYFKQVNDQHGHLAGDAVLAGVGKRLNALVRGNDRIGRYGGEELLALLPGLGADATHRLDALHAGICGDYPTGEVVLPITCSIGVAWRHPGDSVEHLLARADAALYLAKRNGRNRIAYDAAPQLHASDAARNADNAG DBA308170CAED732 xc_0613-rpfg-1 8 24 unspecified role unspecified role bait bait GGDEF domain Region 429-586 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association rpfg-xc_0420-1 10 30 unspecified role unspecified role prey prey GGDEF domain Region 382-537 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 18:00:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 16:47:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y295A'. Wed May 02 17:48:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr295ala' Tue Jun 30 19:47:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr295Ala' Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P296A'. Wed May 02 19:59:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro296ala' Tue Jun 30 17:05:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro296Ala' Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 19:25:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 20:14:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_0249-1 9 28 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_0249-2 20 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 18:52:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 18:51:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' ecolx Escherichia coli physical association physical association rpfg-xc_0249-3 16 28 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xanc8 Xanthomonas campestris pv. campestris (strain 8004) 29 unspecified role unspecified role fluorescence donor fluorescence donor Q4UU85:p.Gly294Ala G294A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 16:31:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 18:48:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 18:23:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 17:32:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xanc8 Xanthomonas campestris pv. campestris (strain 8004) direct interaction direct interaction rpfg-xc_2274-1 12 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_2949-1 11 25 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q4UU85:p.Gly294Ala G294A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 15:25:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 18:38:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.Tyr295Ala Y295A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y295A'. Wed May 02 18:32:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr295ala' Tue Jun 30 17:27:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr295Ala' Q4UU85:p.Pro296Ala P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P296A'. Wed May 02 15:34:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro296ala' Tue Jun 30 19:11:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro296Ala' Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 18:17:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 18:17:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_0420-2 3 30 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction xc_0249-rpfg-1 17 28 unspecified role unspecified role bait bait GGDEF domain Region 182-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association rpfg-xc_2795-1 23 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction xc_1803-rpfg-1 1 32 unspecified role unspecified role bait bait GGDEF domain Region 172-325 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association rpfg-xc_2866-1 15 31 unspecified role unspecified role prey prey GGDEF domain Region 44-204 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 15:42:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 15:54:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y295A'. Wed May 02 15:50:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr295ala' Tue Jun 30 16:59:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr295Ala' Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P296A'. Wed May 02 17:13:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro296ala' Tue Jun 30 15:57:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro296Ala' Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 15:22:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 19:06:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_0613-1 14 24 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_2866-2 4 31 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_2793-1 13 33 unspecified role unspecified role prey prey GGDEF domain Region 399-557 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q4UU85:p.Gly294Ala G294A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 19:24:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 17:00:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.Tyr295Ala Y295A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y295A'. Wed May 02 19:43:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr295ala' Tue Jun 30 17:48:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr295Ala' Q4UU85:p.Pro296Ala P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P296A'. Wed May 02 20:04:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro296ala' Tue Jun 30 19:18:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro296Ala' Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 16:59:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 15:45:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_0613-2 6 24 unspecified role unspecified role prey prey GGDEF domain Region 429-586 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 18:55:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 19:28:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y295A'. Wed May 02 19:03:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr295ala' Tue Jun 30 19:08:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr295Ala' Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P296A'. Wed May 02 18:39:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro296ala' Tue Jun 30 19:48:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro296Ala' Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 15:16:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 17:44:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_0675-1 7 27 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction xc_0675-rpfg-1 19 27 unspecified role unspecified role bait bait GGDEF domain Region 136-288 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association rpfg-xc_1803-1 5 32 unspecified role unspecified role prey prey GGDEF domain Region 172-325 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 15:02:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 19:44:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y295A'. Wed May 02 15:08:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr295ala' Tue Jun 30 20:05:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr295Ala' Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P296A'. Wed May 02 16:07:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro296ala' Tue Jun 30 17:00:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro296Ala' Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 16:23:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 18:13:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_0249-4 21 28 unspecified role unspecified role prey prey GGDEF domain Region 182-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 16:45:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 20:12:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y295A'. Wed May 02 18:25:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr295ala' Tue Jun 30 16:23:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr295Ala' Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P296A'. Wed May 02 18:11:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro296ala' Tue Jun 30 19:36:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro296Ala' Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 19:22:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala,tyr295ala,pro296ala' Tue Jun 30 17:00:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly294Ala;Tyr295Ala;Pro296Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpfg-xc_1803-2 22 32 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction xc_0420-rpfg-1 2 30 unspecified role unspecified role bait bait GGDEF domain Region 382-537 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association rpfg-xc_0420-3 18 30 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xanc8 Xanthomonas campestris pv. campestris (strain 8004) 29 unspecified role unspecified role fluorescence donor fluorescence donor Q4UU85:p.Gly294Ala G294A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G294A'. Wed May 02 16:41:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly294ala' Tue Jun 30 19:31:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294Ala' Q4UU85:p.Gly294_Pro296delinsAlaAlaAla G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain GYP AAA This feature has been corrected as a result of our quality control procedures. The original label was 'G294A/Y295A/P296A'. Wed May 02 20:01:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_tyr_pro294-296ala_ala_ala' Tue Jun 30 16:10:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly294_Pro296delinsAlaAlaAla' HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xanc8 Xanthomonas campestris pv. campestris (strain 8004) direct interaction direct interaction