DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Four generations of transition-state analogues for human purine nucleoside phosphorylase. Four generations of transition-state analogues for human purine nucleoside phosphorylase. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ho MC., Shi W., Rinaldo-Matthis A., Tyler PC., Evans GB., Clinch K., Almo SC., Schramm VL. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ho MC., Shi W., Rinaldo-Matthis A., Tyler PC., Evans GB., Clinch K., Almo SC., Schramm VL. DIP original experiment: DIP-216340X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Four generations of transition-state analogues for human purine nucleoside phosphorylase. pnph_human Purine nucleoside phosphorylase Inosine phosphorylase PNP NP Inosine-guanosine phosphorylase protein protein human Homo sapiens Human MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS DIP protein P00491 original sequence version: 119 91622FB1D26479D3 pnp-4 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction