DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. DIP original experiment: DIP-216324X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey comigration in sds comigration in sds page comigration in sds anti tag western anti tag western blot anti tag western Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. DIP original experiment: DIP-216322X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. DIP original experiment: DIP-216327X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. DIP original experiment: DIP-216326X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. DIP original experiment: DIP-216325X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. DIP original experiment: DIP-216321X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Spreu J., Kuttruff S., Stejfova V., Dennehy KM., Schittek B., Steinle A. DIP original experiment: DIP-216323X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. clc2a_human C-type lectin domain family 2 member A CLEC2A KACL Keratinocyte-associated C-type lectin Proliferation-induced lymphocyte-associated receptor UNQ5792/PRO19597 protein protein human Homo sapiens Human MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL DIP protein Q6UVW9 original sequence version: 47 q9nzs2-1 Killer cell lectin-like receptor subfamily F member 1 KLRF1 CLEC5C ML Activating coreceptor NKp80 C-type lectin domain family 5 member C protein protein human Homo sapiens Human MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY DIP protein Q9NZS2-1 original sequence version: 71 A2F7BE6D4341AFDE clc2b_human C-type lectin domain family 2 member B CLEC2B AICL Activation-induced C-type lectin C-type lectin superfamily member 2 CLECSF2 IFN-alpha-2b-inducing-related protein 1 IFNRG1 protein protein human Homo sapiens Human MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH DIP protein Q92478 original sequence version: 82 0B4FED23424F6C55 klrf2_human Killer cell lectin-like receptor subfamily F member 2 KLRF2 Activating coreceptor NKp65 protein protein human Homo sapiens Human MENEDGYMTLSFKNRCKSKQKSKDFSLYPQYYCLLLIFGCIVILIFIMTGIDLKFWHKKMDFSQNVNVSSLSGHNYLCPNDWLLNEGKCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLDELEFIQNSLKPGHFGWIGLYVTFQGNLWMWIDEHFLVPELFSVIGPTDDRSCAVITGNWVYSEDCSSTFKGICQRDAILTHNGTSGV DIP protein D3W0D1 original sequence version: 8 nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV DIP protein P26718 original sequence version: 106 C22F6BD533D7800E clec2a-klrf2-1 6 8 unspecified role unspecified role bait bait human Homo sapiens Human 11 unspecified role unspecified role prey prey Ectodomain Region 63-207 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction klrf1-1 3 9 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 64-231 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction clec2b-1 1 10 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 26-149 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction klrk1-1 5 12 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 73-216 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction clec2b-2 2 10 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey covalent binding covalent binding klrf2-1 4 11 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 63-207 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction clec2a-1 7 8 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 46-174 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction