DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Light-induced translocation of Drosophila visual Arrestin2 depends on Rac2. Light-induced translocation of Drosophila visual Arrestin2 depends on Rac2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Elsaesser R., Kalra D., Li R., Montell C. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elsaesser R., Kalra D., Li R., Montell C. DIP original experiment: DIP-216313X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Light-induced translocation of Drosophila visual Arrestin2 depends on Rac2. rac2_drome Ras-related protein Rac2 Rac2 RacB CG8556 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCALL DIP protein P48554 original sequence version: 93 06AE11CC18019982 ops1_drome Opsin Rh1 ninaE Rh1 CG4550 Outer R1-R6 photoreceptor cells opsin Neither inactivation nor afterpotential E protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MESFAVAAAQLGPHFAPLSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLFKFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASEAESKA DIP protein P06002 original sequence version: 108 FFF36C90DDD68294 rac2-ninae-1 1 3 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 2 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association