DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. Nature structural & molecular biology 2010 imex curation Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. DIP original experiment: DIP-217022X Nature structural & molecular biology 2010 IMEx The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. Nature structural & molecular biology 2010 imex curation Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. DIP original experiment: DIP-217021X Nature structural & molecular biology 2010 IMEx The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. Nature structural & molecular biology 2010 imex curation Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. DIP original experiment: DIP-217020X Nature structural & molecular biology 2010 IMEx The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. q5sit5_thet8 TTHA1279 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MTGGLVLNAISRAGGAMGGLGLIKSLAEKEKQLLERLEAAKKEAEERVKRAEAEAKALLEEAEAKAKALEAQYRERERAETEALLARYRERAEAEAKAVREKAMARLDEAVALVLKEVLP DIP protein Q5SIT5 original sequence version: 23 FF825EFD697B1C4A vate_thet8 V-type ATP synthase subunit E atpE V-ATPase subunit E vatE TTHA1276 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSKLEAILSQEVEAEIQALLQEAEAKAEAVKREAEEKAKALLQARERALEAQYRAALRRAESAGELLVATARTQARGEVLEEVRRRVREALEALPQKPEWPEVVRKLALEALEALPGAKALVANPEDLPHLEALARERGVELQAEPALRLGVRAVGAEGKTQVENSLLARLDRAWDALSSKVAQALWG DIP protein P74901 original sequence version: 62 A6758A3A22200774 q5sit5_thet8-atpe-1 3 4 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 5 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association atpe-q5sit5_thet8-1 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction atpe-q5sit5_thet8-2 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction