DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. DIP original experiment: DIP-220925X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. DIP original experiment: DIP-220923X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. DIP original experiment: DIP-220924X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. DIP original experiment: DIP-220927X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. DIP original experiment: DIP-220922X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. DIP original experiment: DIP-220921X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Haurie V., Durrieu-Gaillard S., Dumay-Odelot H., Da Silva D., Rey C., Prochazkova M., Roeder RG., Besser D., Teichmann M. DIP original experiment: DIP-220926X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation. rpc3_human DNA-directed RNA polymerase III subunit RPC3 POLR3C DNA-directed RNA polymerase III subunit C RNA polymerase III 62 kDa subunit protein protein human Homo sapiens Human MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ DIP protein Q9BUI4 original sequence version: 73 0E4CFEE295EE1A55 rpc7_human DNA-directed RNA polymerase III subunit RPC7 POLR3G DNA-directed RNA polymerase III subunit G RNA polymerase III 32 kDa subunit RNA polymerase III 32 kDa apha subunit protein protein human Homo sapiens Human MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY DIP protein O15318 original sequence version: 68 95E506D527962DD9 rpc6_human DNA-directed RNA polymerase III subunit RPC6 DNA-directed RNA polymerase III subunit F RNA polymerase III 39 kDa subunit POLR3F protein protein human Homo sapiens Human MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEWLEF DIP protein Q9H1D9 original sequence version: 91 49B1360AF8B365ED rpc4_human DNA-directed RNA polymerase III subunit RPC4 BN51 BN51T DNA-directed RNA polymerase III subunit D Protein BN51 RNA polymerase III 47 kDa subunit RPC53 homolog POLR3D protein protein human Homo sapiens Human MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR DIP protein P05423 original sequence version: 105 CD8AFF3257B78410 rpc7l_human DNA-directed RNA polymerase III subunit RPC7-like POLR3GL RNA polymerase III 32 kDa beta subunit DNA-directed RNA polymerase III subunit G-like protein protein human Homo sapiens Human MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKTTEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSDDNMDEAIY DIP protein Q9BT43 original sequence version: 58 01E3B35D7279E43E polr3f-polr3g-1 1 9 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association polr3d-polr3f-1 6 9 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association polr3gl-polr3c-3 2 12 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human association association polr3f-polr3gl-1 4 12 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association polr3g-polr3c-1 5 8 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human association association polr3f-polr3gl-2 7 12 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association polr3f-polr3g-2 3 9 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association