DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220902X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220903X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220896X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220899X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220901X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220898X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220904X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220900X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220906X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220895X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220905X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yang Y., Yan X., Cai Y., Lu Y., Si J., Zhou T. DIP original experiment: DIP-220897X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90. hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD DIP protein P07900 original sequence version: 197 DIP protein P07900 original sequence version: 116 DIP protein P07900 original sequence version: 150 DIP protein P07900-1 original sequence version: 158 DIP protein P07900 original sequence version: 207 DIP protein P07900 original sequence version: 192 DIP protein P07900 original sequence version: 156 969F65FCC0BC86FD lis1_human Platelet-activating factor acetylhydrolase IB subunit beta PAF acetylhydrolase 45 kDa subunit PAF-AH alpha Lissencephaly-1 protein PAFAH1B1 LIS1 MDCR PAFAHA MDS protein protein human Homo sapiens Human MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR DIP protein P43034 original sequence version: 155 DIP protein P43034 original sequence version: 117 3AB68D2641BA31C9 nudc2_human NudC domain-containing protein 2 NUDCD2 protein protein human Homo sapiens Human MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK This sequence has been withdrawn from Uniprot. 8A425EA4F6F321FD 8A425EA4F6F321FD nudcl2-hsp90aa1-1 12 13 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association nudcl2-hsp90aa1-2 10 14 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait human Homo sapiens Human association association pafah1b1-hsp90aa1-1 5 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role prey prey human Homo sapiens Human association association pafah1b1-hsp90aa1-2 2 13 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association pafah1b1-hsp90aa1-3 11 14 unspecified role unspecified role bait bait human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role prey prey human Homo sapiens Human association association nudcl2-hsp90aa1-3 7 13 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association nudcl2-pafah1b1-1 3 14 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association pafah1b1-hsp90aa1-4 6 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association nudcl2-pafah1b1-2 8 14 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal domain Region 109-157 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association pafah1b1-nudcl2-1 1 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal domain Region 109-157 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association nudcl2-hsp90aa1-4 4 14 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association pafah1b1-hsp90aa1-5 9 14 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association