DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Romero D., Aguilar C., Losick R., Kolter R. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Romero D., Aguilar C., Losick R., Kolter R. DIP original experiment: DIP-215933X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Romero D., Aguilar C., Losick R., Kolter R. Only protein-protein interactions baciu Bacillus subtilis fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Romero D., Aguilar C., Losick R., Kolter R. DIP original experiment: DIP-215930X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Romero D., Aguilar C., Losick R., Kolter R. Only protein-protein interactions baciu Bacillus subtilis tem transmission electron microscopy tem predetermined predetermined participant predetermined Romero D., Aguilar C., Losick R., Kolter R. DIP original experiment: DIP-215929X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Romero D., Aguilar C., Losick R., Kolter R. Only protein-protein interactions baciu Bacillus subtilis molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Romero D., Aguilar C., Losick R., Kolter R. DIP original experiment: DIP-215931X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Romero D., Aguilar C., Losick R., Kolter R. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Romero D., Aguilar C., Losick R., Kolter R. DIP original experiment: DIP-215934X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Romero D., Aguilar C., Losick R., Kolter R. Only protein-protein interactions in vitro In vitro polymerization polymerization predetermined predetermined participant predetermined Romero D., Aguilar C., Losick R., Kolter R. DIP original experiment: DIP-215932X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Amyloid fibers provide structural integrity to Bacillus subtilis biofilms. tasa_bacsu Major biofilm matrix component tasA cotN yqhF BSU24620 Spore coat-associated protein N Translocation-dependent antimicrobial spore component protein protein bacsu Bacillus subtilis MGMKKKLSLGVASAALGLALVGGGTWAAFNDIKSKDATFASGTLDLSAKENSASVNLSNLKPGDKLTKDFQFENNGSLAIKEVLMALNYGDFKANGGSNTSPEDFLSQFEVTLLTVGKEGGNGYPKNIILDDANLKDLYLMSAKNDAAAAEKIKKQIDPKFLNASGKVNVATIDGKTAPEYDGVPKTPTDFDQVQMEIQFKDDKTKDEKGLMVQNKYQGNSIKLQFSFEATQWNGLTIKKDHTDKDGYVKENEKAHSEDKN 08C6B75785D8E1FA tasa-1 3 7 unspecified role unspecified role unspecified role unspecified role Mature protein Region 28-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain baciu Bacillus subtilis direct interaction direct interaction tasa-2 6 7 unspecified role unspecified role unspecified role unspecified role Mature protein Region 28-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain baciu Bacillus subtilis direct interaction direct interaction tasa-3 1 7 unspecified role unspecified role unspecified role unspecified role Mature protein Region 28-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain baciu Bacillus subtilis direct interaction direct interaction tasa-4 2 7 unspecified role unspecified role unspecified role unspecified role Mature protein Region 28-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain baciu Bacillus subtilis direct interaction direct interaction tasa-5 4 7 unspecified role unspecified role unspecified role unspecified role Mature protein Region 28-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain baciu Bacillus subtilis direct interaction direct interaction tasa-6 5 7 unspecified role unspecified role unspecified role unspecified role Mature protein Region 28-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain baciu Bacillus subtilis direct interaction direct interaction