DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. DIP original experiment: DIP-215928X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. DIP original experiment: DIP-215924X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. DIP original experiment: DIP-215927X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. DIP original experiment: DIP-215926X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pazy Y., Motaleb MA., Guarnieri MT., Charon NW., Zhao R., Silversmith RE. DIP original experiment: DIP-215925X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. o51615_borbu BB_0672 protein protein strain atcc 35210 / Borrelia burgdorferi MIQKTTIAADSSSKPRGINYDTGIPFNVLIVDDSVFTVKQLTQIFTSEGFNIIDTAADGEEAVIKYKNHYPNIDIVTLDITMPKMDGITCLSNIMEFDKNARVIMISALGKEQLVKDCLIKGAKTFIVKPLDRAKVLQRVMSVFVK AE1437D4678E58A1 o51614_borbu BB_0671 protein protein strain atcc 35210 / Borrelia burgdorferi MRIDYIEPFLDAASSVLRDMLLVENIEMGKPGLKSINQKIKGVSVIVGLAGSVEGSIIIDMDIETALFVASKLNFEEYDDFDDEETKEMVAATLTEVGNIIAGNFVTTLHAKGFVFDITPPAFIYGENMKISNKGSEALIVPFSLPDGKIIEVNIAIRERV 80177F402DF60A54 chex-chey_3-1 2 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction chex-chey_3-2 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction chex-1 5 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction chex-2 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction chex-chey_3-3 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction