IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. I have added the promoter region numbers, where possible, as a comment on participant feature - I can see no other option, as the new "probe" annotation is not appropriate. Fig 2E: the text says ALL Ef2s give a +ve result in Chip - but I can see NO band for E2F4 - so not entered. rRNA Promoter maps to several genomic regions; is a 'repeat unit'. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. Re-ChIP experiment RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B. The Journal of Biological Chemistry 2010 imex curation Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu Accepted 2017-DEC-14 AT 09:13 GMT AT 09:13 GMT by LIVIAP The Journal of Biological Chemistry 2010 imex curation altered; I have altered to Phys. Assoc and added Cell lysate for Prey. However as binding IS demonstrated by the E2F1 region 110-284 Sandra and I have always shown this as "Sufficient to Bind", and use "Required to bind" only in absence of positive binding - which is not the case here. Have discussed this with Pablo and as a result have added both "Required" and Sufficient to bind. (maybe this needs to be discussed between us more? as Pablo uses the term differently than me.) The term "Sufficient to Bind" has always taken higher priority than "Required" - according to Sandra..and is a lower level term in OLS.; I have added ONE interaction (e2fi/e2f1) from first column. added 4 for second column. rrp1b_human_gene Ribosomal RNA processing protein 1 homolog B RRP1B KIAA0179 gene gene human Homo sapiens Human tp73_human_gene Human TP73 gene gene gene human Homo sapiens Human rbl1_human_gene RBL1 protein gene gene gene human Homo sapiens Human kith_human_gene Thymidine kinase, cytosolic TK1 gene gene human Homo sapiens Human e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF DIP protein Q01094 original sequence version: 173 DIP protein Q01094 original sequence version: 168 DIP protein Q01094 original sequence version: 149 DIP protein Q01094 original sequence version: 130 DIP protein Q01094 original sequence version: 125 DIP protein Q01094 original sequence version: 153 DIP protein Q01094 original sequence version: 180 003B3F654F0C60DF e2f3_human Transcription factor E2F3 E2F3 KIAA0075 protein protein human Homo sapiens Human MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS DIP protein O00716 original sequence version: 137 4641565842CA99EC casp3_human_gene Caspase-3 CPP32 CASP3 gene gene human Homo sapiens Human rrna promoter rRNA promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human CCAGAGGACAGCGTGTCAGCA reverse sequence given only: maps to one of 45S rDNA repeat units encoding a 45S rRNA precursor, transcribed by RNA polymerase I, which is processed to form the 18S, 5.8S and 28S rRNAs. e2f1_human_gene Human transcription factor E2F1 gene gene human Homo sapiens Human e2f2_human Transcription factor E2F2 E2F2 protein protein human Homo sapiens Human MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN DIP protein Q14209 original sequence version: 133 60541F4235507005 rrp1b_human Ribosomal RNA processing protein 1 homolog B RRP1B RRP1-like protein B KIAA0179 protein protein human Homo sapiens Human MAPAMQPAEIQFAQRLASSEKGIRDRAVKKLRQYISVKTQRETGGFSQEELLKIWKGLFYCMWVQDEPLLQEELANTIAQLVHAVNNSAAQHLFIQTFWQTMNREWKGIDRLRLDKYYMLIRLVLRQSFEVLKRNGWEESRIKVFLDVLMKEVLCPESQSPNGVRFHFIDIYLDELSKVGGKELLADQNLKFIDPFCKIAAKTKDHTLVQTIARGVFEAIVDQSPFVPEETMEEQKTKVGDGDLSAEEIPENEVSLRRAVSKKKTALGKNHSRKDGLSDERGRDDCGTFEDTGPLLQFDYKAVADRLLEMTSRKNTPHFNRKRLSKLIKKFQDLSEGSSISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTGEESGSEHPPAVPMHNKRKRPRKKSPRAHREMLESAVLPPEDMSQSGPSGSHPQGPRGSPTGGAQLLKRKRKLGVVPVNGSGLSTPAWPPLQQEGPPTGPAEGANSHTTLPQRRRLQKKKAGPGSLELCGLPSQKTASLKKRKKMRVMSNLVEHNGVLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKFDTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSPASSPLVAKKPLTTTPRRRPRAMDFF 738117A7062054F2 casp7_human_gene Human CASP7 gene gene gene human Homo sapiens Human 235a34t4-1 2 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RRP1B promoter from position +79 to +259 association association Figure 2E, 4D e2f1-rrp1b-1 2 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Figure 2E -2 e2f1-rbl1_human_gene-1 2 19 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Figure 2E -3 e2f2-rbl1_human_gene-1 2 15 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Figure 2E -4 e2f1-rrp1b-2 2 20 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4Da e2f1-casp3-1 2 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4D-3 e2f1-rrna promoter-1 2 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association 4D-4 e2f1-casp3-2 2 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4D-5 e2f1-tp73_human_gene-1 2 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4D-6 e2f1-rrp1b-3 4 20 unspecified role unspecified role bait bait partially purified partially purified 14 unspecified role unspecified role prey prey partially purified partially purified 10 unspecified role unspecified role prey prey partially purified partially purified promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RRP1B promoter from position +79 to +259 association association Figure 4E-1 e2f1-casp7_human_gene-1 4 14 unspecified role unspecified role prey prey partially purified partially purified 21 unspecified role unspecified role prey prey partially purified partially purified promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait partially purified partially purified association association 4E-2 e2f1-rrna promoter-2 4 20 unspecified role unspecified role bait bait partially purified partially purified 14 unspecified role unspecified role prey prey partially purified partially purified 17 unspecified role unspecified role prey prey partially purified partially purified association association 4E-3 rrp1b-casp7_human_gene-1 6 14 unspecified role unspecified role bait bait purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep in vitro translated in vitro translated protein in vitro translated n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 5A 21311213-1 1 20 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 6B e2f1-rrp1b-4 3 20 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 6Bi rrp1b-e2f1-1 5 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 20 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6C e2f1-rrp1b-5 8 14 unspecified role unspecified role bait bait purified purified DNA-binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range DNA-binding domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 6D e2f1-rrp1b-6 9 14 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7C e2f1-rrp1b-7 7 14 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7Ci e2f1-casp3-3 2 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4D-7 e2f1-casp7_human_gene-2 2 20 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4Db e2f1-rrna promoter-3 2 20 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association 4Dc e2f1-rrp1b-8 2 20 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RRP1B promoter from position +79 to +259 association association Figure 4Dd