IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. Nature immunology 2010 imex curation Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org Accepted 2017-MAR-31 AT 08:39 BST AT 08:39 BST by ORCHARD Nature immunology 2010 imex curation added + comment "very weak interaction"! (altered to Physical" - but keeps on reverting to Association; EBI-13941132:- I have removed the MISY fragment altogether-I hope this is what you meant? CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. Nature immunology 2010 imex curation Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. I found a GO term for "intracellular"! kathryn.moore@nyumc.org Accepted 2017-MAR-31 AT 08:39 BST AT 08:39 BST by ORCHARD Nature immunology 2010 imex curation added + comment "very weak interaction"! (altered to Physical" - but keeps on reverting to Association; EBI-13941132:- I have removed the MISY fragment altogether-I hope this is what you meant? CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. Nature immunology 2010 imex curation Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org Accepted 2017-MAR-31 AT 08:39 BST AT 08:39 BST by ORCHARD Nature immunology 2010 imex curation added + comment "very weak interaction"! (altered to Physical" - but keeps on reverting to Association; EBI-13941132:- I have removed the MISY fragment altogether-I hope this is what you meant? CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. Nature immunology 2010 imex curation Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. DSP=73? already grabbed (being curated) by DIP- but not released - still "INPROGRESS" since Sept 2016. Mouse CD36 is used for transfection- not human. 20/2/17 Lucasz says I can have this publication;problem with species! kathryn.moore@nyumc.org Accepted 2017-MAR-31 AT 08:39 BST AT 08:39 BST by ORCHARD Nature immunology 2010 imex curation added + comment "very weak interaction"! (altered to Physical" - but keeps on reverting to Association; EBI-13941132:- I have removed the MISY fragment altogether-I hope this is what you meant? CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. Nature immunology 2010 imex curation Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org Accepted 2017-MAR-31 AT 08:39 BST AT 08:39 BST by ORCHARD Nature immunology 2010 imex curation added + comment "very weak interaction"! (altered to Physical" - but keeps on reverting to Association; EBI-13941132:- I have removed the MISY fragment altogether-I hope this is what you meant? CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. Nature immunology 2010 imex curation Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-c32 C32 melanoma cell line, amelanotic (colourless) Human c32 C32 melanoma cell line, amelanotic (colourless) https://www.lgcstandards-atcc.org/products/all/CRL-1585 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ., Stewart CR., Stuart LM., Wilkinson K., van Gils JM., Deng J., Halle A., Rayner KJ., Boyer L., Zhong R., Frazier WA., Lacy-Hulbert A., El Khoury J., Golenbock DT., Moore KJ. kathryn.moore@nyumc.org Accepted 2017-MAR-31 AT 08:39 BST AT 08:39 BST by ORCHARD Nature immunology 2010 imex curation added + comment "very weak interaction"! (altered to Physical" - but keeps on reverting to Association; EBI-13941132:- I have removed the MISY fragment altogether-I hope this is what you meant? tlr4_human Toll-like receptor 4 TLR4 hToll protein protein human Homo sapiens Human MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI 92C48F55821133E8 cd36_mouse Platelet glycoprotein 4 Cd36 Platelet glycoprotein IV PAS IV PAS-4 Glycoprotein IIIb protein protein mouse Mus musculus Mouse MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDMLIEKTIKREVVLEEGTTAFKNWVKTGTTVYRQFWIFDVQNPDDVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGAIFEPSLSVGTEDDNFTVLNLAVAAAPHIYQNSFVQVVLNSLIKKSKSSMFQTRSLKELLWGYKDPFLSLVPYPISTTVGVFYPYNDTVDGVYKVFNGKDNISKVAIIESYKGKRNLSYWPSYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEIDLKGIPVYRFVLPANAFASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGLHPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETGTIGDEKAEMFKTQVTGKIKLLGMVEMALLGIGVVMFVAFMISYCACKSKNGK mint Seems to have numerous potential physiological functions. Binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. May function as a cell adhesion molecule. Directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport 80AEABB18206534F cd36_human Platelet glycoprotein 4 GP3B GP4 Platelet glycoprotein IV Glycoprotein IIIb Leukocyte differentiation antigen CD36 PAS IV PAS-4 Platelet collagen receptor Fatty acid translocase Thrombospondin receptor CD36 protein protein human Homo sapiens Human MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK 543E748259A094FA paxi_human Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC DIP protein P49023 original sequence version: 115 DIP protein P49023 original sequence version: 126 DIP protein P49023 original sequence version: 169 DIP protein P49023 original sequence version: 140 DIP protein P49023 original sequence version: 175 ABF6C0BE5939623F tlr6_human Toll-like receptor 6 TLR6 protein protein human Homo sapiens Human MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMSQNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPIVSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREFVKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAVTVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSELVPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANIRAAFNMKLTLVTENNDVKS 9ACEAEC084CB466C lyn_human Tyrosine-protein kinase Lyn JTK8 Lck/Yes-related novel protein tyrosine kinase V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn LYN protein protein human Homo sapiens Human MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP DIP protein P07948 original sequence version: 141 408D3D461204E378 fak1_human Focal adhesion kinase 1 PTK2 FAK FAK1 pp125FAK Protein-tyrosine kinase 2 Focal adhesion kinase-related nonkinase Protein phosphatase 1 regulatory subunit 71 p125FAK protein protein human Homo sapiens Human MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH D8A4C15138AB0243 4234-1 4 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 5 A/B, 6E oxidized LDL amyloid-beta peptide, amino acids 1–42 The authors state that "treatment with the Lyn kinase inhibitor PP1...blocked the physical association of CD36 with TLR4 and TLR6 in oxLDL-treated monocytes". cd36-tlr4-1 2 8 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component c_terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 5C oxidized LDL Minimal colocalization of CD36, TLR4 and TLR6 was seen in resting cells, but upon treatment with oxLDL, CD36, TLR4 and TLR6 colocalized predominantly in intracellular compartments. cd36-tlr4-2 3 8 immunocytochemistry immunocytochemistry western blot western blot Immuno blot Immuno blot unspecified role unspecified role ancillary ancillary Q08857:p.Tyr463Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:49:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr463phe' Tue Jun 30 16:03:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr463Phe' 7 unspecified role unspecified role bait bait c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey association association 6B oxidized LDL lyn-cd36-3 1 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 6C-top lyn-cd36-1 5 10 unspecified role unspecified role prey prey possible_phosphres nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] 9 unspecified role unspecified role bait bait c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role prey prey possible_phosres nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] association association Supp figure 4A Results from blasting the CD36 peptide sequence used for Pull down gives 100% homology with Human CD36, but only ~90% with the Mouse protein. A protein of approximately 60 kDa was also pulled down- and shown to be Lyn.. cd36-lyn-1 5 9 competitor competitor competitor unspecified role unspecified role c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MISY_fragment required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role bait bait c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 6C-bottom-i Results from blasting the CD36 peptide sequence used for Pull down gives 100% homology with Human CD36, but only ~90% with the Mouse protein. cd36-lyn-2 5 9 unspecified role unspecified role bait bait c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey cell lysate cell lysate human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig 6C -bottom figure Results from blasting the CD36 peptide sequence used for Pull down gives 100% homology with Human CD36, but only ~90% with the Mouse protein. lyn-cd36-2 1 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Supp figure 4B I have not entered any "possible phos_res" as there is no statement in the text as to what was found; cd36-lyn-3 6 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Supp figure 4Bi I have not entered any "possible phos_res" as there is no statement in the text as to what was found;there is only one band showing that reacts with 4G10- identity? No mention of any transfection wrt this cell line - so used HUMAN CD36. tlr4-tlr6-1 3 7 unspecified role unspecified role bait bait c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey physical association physical association 6B lane 2 very weak interaction