DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. Only protein-protein interactions Shewanella oneidensis Shewanella oneidensis molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. DIP original experiment: DIP-134890X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. Only protein-protein interactions Shewanella oneidensis Shewanella oneidensis molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column ms participant Identification by mass spectrometry ms participant Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. DIP original experiment: DIP-134893X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. DIP original experiment: DIP-134889X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. DIP original experiment: DIP-134891X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. Only protein-protein interactions Shewanella oneidensis Shewanella oneidensis solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. DIP original experiment: DIP-134888X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Characterization of an electron conduit between bacteria and the extracellular environment. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. Only protein-protein interactions Shewanella oneidensis Shewanella oneidensis solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Hartshorne RS., Reardon CL., Ross D., Nuester J., Clarke TA., Gates AJ., Mills PC., Fredrickson JK., Zachara JM., Shi L., Beliaev AS., Marshall MJ., Tien M., Brantley S., Butt JN., Richardson DJ. DIP original experiment: DIP-134892X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Characterization of an electron conduit between bacteria and the extracellular environment. q8eg35_sheon mtrA SO_1777 protein protein sheon Shewanella oneidensis (strain MR-1) MKNCLKMKNLLPALTITMAMSAVMALVVTPNAYASKWDEKMTPEQVEATLDKKFAEGNYSPKGADSCLMCHKKSEKVMDLFKGVHGAIDSSKSPMAGLQCEACHGPLGQHNKGGNEPMITFGKQSTLSADKQNSVCMSCHQDDKRMSWNGGHHDNADVACASCHQVHVAKDPVLSKNTEMEVCTSCHTKQKADMNKRSSHPLKWAQMTCSDCHNPHGSMTDSDLNKPSVNDTCYSCHAEKRGPKLWEHAPVTENCVTCHNPHGSVNDGMLKTRAPQLCQQCHASDGHASNAYLGNTGLGSNVGDNAFTGGRSCLNCHSQVHGSNHPSGKLLQR 72F75E3532B8E847 o87540_shepu mtrC protein protein shepu shepu Pseudomonas putrefaciens MMNAQKSKIALLLAASAVTMALTGCGGSSGNNGNDGSDGGEPAGSIQTLNLDITKVSYENGAPMVTVFATNEADMPVIGLANLEIKKALQLIPEGATGPGNSANWQGLGSSKSYVDNKNGSYTFKFDAFDSNKVFNAQLTQRFNVVSAAGKLADGTTVPVAEMVEDFDGQGNAPQYTKNIVSHEVCASCHVEGEKIYHQATEVETCISCHTQEFADGRGKPHVAFSHLIHNVHNANKAWGKDNKIPTVAQNIVQDNCQVCHVESDMLTEAKNWSRIPTMEVCSSCHVDIDFAAGKGHSQQLDNSNCIACHNSDWTAELHTAKTTATKNLINQYGIETTSTINTETKAATISVQVVDANGTAVDLKTILPKVQRLEIITNVGPNNATLGYSGKDSIFAIKNGALDPKATINDAGKLVYTTTKDLKLGQNGADSDTAFSFVGWSMCSSEGKFVDCADPAFDGVDVTKYTGMKADLAFATLSGKAPSTRHVDSVNMTACANCHTAEFEIHKGKQHAGFVMTEQLSHTQDANGKAIVGLDACVTCHTPDGTYSFANRGALELKLHKKHVEDAYGLIGGNCASCHSDFNLESFKKKGALNTAAAADKTGLYSTPITATCTTCHTVGSQYMVHTKETLESFGAVVDGTKDDATSAAQSETCFYCHTPTVADHTKVKM E50F612FA9674BE9 q8cvd4_sheon mtrB SO_1776 protein protein sheon Shewanella oneidensis (strain MR-1) MKFKLNLITLALLANTGLAVAADGYGLANANTEKVKLSAWSCKGCVVETGTSGTVGVGVGYNSEEDIRSANAFGTSNEVAGKFDADLNFKGEKGYRASVDAYQLGMDGGRLDVNAGKQGQYNVNVNYRQIATYDSNSALSPYAGIGGNNLTLPDNWITAGSSNQMPLLMDSLNALELSLKRERTGLGFEYQGESLWSTYVNYMREEKTGLKQASGSFFNQSMMLAEPVDYTTDTIEAGVKLKGDRWFTALSYNGSIFKNEYNQLDFENAFNPTFGAQTQGTMALDPDNQSHTVSLMGQYNDGSNALSGRILTGQMSQDQALVTDNYRYANQLNTDAVDAKVDLLGMNLKVVSKVSNDLRLTGSYDYYDRDNNTQVEEWTQISINNVNGKVAYNTPYDNRTQRFKVAADYRITRDIKLDGGYDFKRDQRDYQDRETTDENTVWARLRVNSFDTWDMWVKGSYGNRDGSQYQASEWTSSETNSLLRKYNLADRDRTQVEARITHSPLESLTIDVGARYALDDYTDTVIGLTESKDTSYDANISYMITADLLATAFYNYQTIESEQAGSSNYSTPTWTGFIEDQVDVVGAGISYNNLLENKLRLGLDYTYSNSDSNTQVRQGITGDYGDYFAKVHNINLYAQYQATEKLALRFDYKIENYKDNDAANDIAVDGIWNVVGFGSNSHDYTAQMLMLSMSYKL BF630F6A80E7CA22 mtra-mtrb-1 1 8 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 9 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 7 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis physical association physical association mtra-mtrb-2 5 8 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 9 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 7 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis physical association physical association mtra-mtrb-3 2 9 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 7 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis direct interaction direct interaction mtra-mtrc-1 4 8 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 7 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis direct interaction direct interaction mtra-mtrb-4 3 8 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 9 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 7 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis physical association physical association mtra-mtrb-5 6 9 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis 7 unspecified role unspecified role unspecified role unspecified role Shewanella oneidensis Shewanella oneidensis direct interaction direct interaction