DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses. The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Coulibaly F., Chiu E., Gutmann S., Rajendran C., Haebel PW., Ikeda K., Mori H., Ward VK., Schulze-Briese C., Metcalf P. Only protein-protein interactions Wiseana signata Wiseana signata x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Coulibaly F., Chiu E., Gutmann S., Rajendran C., Haebel PW., Ikeda K., Mori H., Ward VK., Schulze-Briese C., Metcalf P. DIP original experiment: DIP-134880X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses. The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses. The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Coulibaly F., Chiu E., Gutmann S., Rajendran C., Haebel PW., Ikeda K., Mori H., Ward VK., Schulze-Briese C., Metcalf P. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Coulibaly F., Chiu E., Gutmann S., Rajendran C., Haebel PW., Ikeda K., Mori H., Ward VK., Schulze-Briese C., Metcalf P. DIP original experiment: DIP-134879X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses. pyhd_npvac Polyhedrin PH P29 POLH Major occlusion protein protein protein npvac Autographa californica nuclear polyhedrosis virus (AcMNPV) AcMNPV MPDYSYRPTIGRTYVYDNKYYKNLGAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKPDTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFLVVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSWVGSNNEYRISLAKKGGGCPIMNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLFTGPAY DIP protein P04871 original sequence version: 46 mint F5F5FE9A9BF8189E o37157_9abac Polyhedrin Major occlusion protein protein protein wiseana signata nucleopolyhedrovirus Wiseana signata nucleopolyhedrovirus MYTAYPYPKGKTYVYDNRYWKNLGGVIKNAKRRKHEEEQEKVEREFDSLDKYLVAEDPFCGPGKNQKLTLFKEIRNIKPDTMKLIVNWSGKEFLRETWTRFMEDSFPIVNDQEVMDVFLVINMRSTKPNRCFRFLAQHALRCDPDYVPHEIIRIVEPSYVGNNEYRISLAKRGGGCPIMNLHLEYTNSFEHFINKVIWENFYKPIVYIGTDSAEDEEVLFEVSLVFKIKEFAPDAPLFSGPAY DIP protein O37157 original sequence version: 26 ph-1 2 3 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction o37157_9abac-1 1 4 unspecified role unspecified role unspecified role unspecified role Wiseana signata Wiseana signata direct interaction direct interaction