DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. DIP original experiment: DIP-134852X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. DIP original experiment: DIP-134850X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. DIP original experiment: DIP-134847X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. DIP original experiment: DIP-134854X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. DIP original experiment: DIP-134853X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. DIP original experiment: DIP-134848X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. DIP original experiment: DIP-134851X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen YH., Choi K., Szakal B., Arenz J., Duan X., Ye H., Branzei D., Zhao X. DIP original experiment: DIP-134849X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Interplay between the Smc5/6 complex and the Mph1 helicase in recombinational repair. smc6_yeast Structural maintenance of chromosomes protein 6 SMC6 DNA repair protein RHC18 Rad18 homolog RHC18 L3502.2 YLR383W protein protein yeast Saccharomyces cerevisiae Baker's yeast MISTTISGKRPIEQVDDELLSLTAQQENEEQQQQRKRRRHQFAPMTQFNSNTLDEDSGFRSSSDVATADQDNFLEESPSGYIKKVILRNFMCHEHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSLKDLIREGCYSAKIILHLDNSKYGAYQQGIFGNEIIVERIIKRDGPASFSLRSENGKEISNKKKDIQTVVDYFSVPVSNPMCFLSQDAARSFLTASTSQDKYSHFMKGTLLQEITENLLYASAIHDSAQENMALHLENLKSLKAEYEDAKKLLRELNQTSDLNERKMLLQAKSLWIDVAHNTDACKNLENEISGIQQKVDEVTEKIRNRQEKIERYTSDGTTIEAQIDAKVIYVNEKDSEHQNARELLRDVKSRFEKEKSNQAEAQSNIDQGRKKVDALNKTIAHLEEELTKEMGGDKDQMRQELEQLEKANEKLREVNNSLVVSLQDVKNEERDIQHERESELRTISRSIQNKKVELQNIAKGNDTFLMNFDRNMDRLLRTIEQRKNEFETPAIGPLGSLVTIRKGFEKWTRSIQRAISSSLNAFVVSNPKDNRLFRDIMRSCGIRSNIPIVTYCLSQFDYSKGRAHGNYPTIVDALEFSKPEIECLFVDLSRIERIVLIEDKNEARNFLQRNPVNVNMALSLRDRRSGFQLSGGYRLDTVTYQDKIRLKVNSSSDNGTQYLKDLIEQETKELQNIRDRYEEKLSEVRSRLKEIDGRLKSTKNEMRKTNFRMTELKMNVGKVVDTGILNSKINERKNQEQAIASYEAAKEELGLKIEQIAQEAQPIKEQYDSTKLALVEAQDELQQLKEDINSRQSKIQKYKDDTIYYEDKKKVYLENIKKIEVNVAALKEGIQRQIQNACAFCSKERIENVDLPDTQEEIKRELDKVSRMIQKAEKSLGLSQEEVIALFEKCRNKYKEGQKKYMEIDEALNRLHNSLKARDQNYKNAEKGTCFDADMDFRASLKVRKFSGNLSFIKDTKSLEIYILTTNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIARTQTIIITPQDIGKIADIDSSGVSIHRMRDPERQNNSNFYN 55C166C5B72CD957 55C166C5B72CD957 mph1_yeast ATP-dependent DNA helicase MPH1 YIR002C YIB2C MPH1 Mutator phenotype protein 1 FANCM-like protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MASADDYFSDFEDDELDKLYEKAINKSVKETITRRAVPVQKDLHDNVLPGQKTVYEEIQRDVSFGPTHHELDYDALSFYVYPTNYEVRDYQYTIVHKSLFQNTLCAIPTGMGKTFIASTVMLNYFRWTKKAKIIFTAPTRPLVAQQIKACLGITGIPSDQTAILLDKSRKNREEIWANKRVFFATPQVVENDLKRGVLDPKDIVCLVIDEAHRATGSSAYTNVVKFIDRFNSSYRLLALTATPASDLEGVQEVVNNLDISKIEIRTEESMDIVKYMKKRKKEKIEVPLLLEIEDIIEQLGMAVKPVLQQAIELGIYEECDPSQINAFKAMQQSQKIIANPTIPEGIKWRNFFILQLLNNVGQMLKRLKIYGIRTFFNYFQNKCTEFTTKYNLKKSTNKIAAEFYYHPILKNIKNQCENYLSDPKFVGHGKLQCVRDELMDFFQKRGSDSRVIIFTELRESALEIVKFIDSVADDQIRPHIFIGQARAKEGFDEVKYTRKHAPKGRKKVERLHRQEQEKFLEAERTKRAANDKLERSARRTGSSEEAQISGMNQKMQKEVIHNFKKGEYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGKIVLLFSSNESYKFERAMEDYSTLQALISKQCIDYKKSDRIIPEDIIPECHETLITINDENEIINEMEDVDEVIRYATQCMMGKKVKPKKAITKKKRVQENKKPKKFFMPDNVETSIVSASTLINKFLVNESGGKQLVTSNENPSKKRKIFKALDNLENDSTEEASSSLETEDEEVSDDNNVFIAEGQNGCQKDLETAIIRTGESLTTLKPLHNFERPNMALFVNDCGLPTKIEKNVKDIRGNQHNLEKEKSCTVDKNNMVLSLDDWNFFRNRYIPEGVSFDVEPNFVQYTKGVKVPHCHKVSKIITLFNDESNDNKKRTIDMNYTKCLARGMLRDEKKFVKVNDKSQVDNNSVNHDSSQSFTLSNAELDDILGSDSDF 474DDC99C543171F 474DDC99C543171F kre29_yeast DNA repair protein KRE29 YER038C Killer toxin-resistance protein 29 KRE29 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSVNSSPNEEFETVPDSQISGFDSPLIPTSVGSYFRDDDDDEKVHPNFISDPENDSLNSDEEFSSLENSDLNLSGAKAESGDDFDPILKRTIISKRKAPSNNEDEEIVKTPRKLVNYVPLKIFNLGDSFDDTITTTVAKLQDLKKEILDSPRSNKSIVITSNTVAKSELQKSIKFSGSIPEIYLDVVTKETISDKYKDWHFISKNCHYEQLMDLEMKDTAYSFLFGSSRSQGKVPEFVHLKCPSITNLLVLFGVNQEKCNSLKINYEKKENSRYDNLCTIFPVNKMLKFLMYFYSDDDNDDVREFFLKAFICLILDRKVFNAMESDHRLCFKVLELFNEAHFINSYFEIVDKNDFFLHYRLLQIFPHLQSALLRRRFSEKQGRTETIQQNIIKEFNEFFDCKNYKNLLYFILTMYGSKFIPFGPKCQVTEYFKDCILDISNETTNDVEISILKGILNLFSKIR 0E35F6857ECA5BBD 0E35F6857ECA5BBD smt3_yeast Ubiquitin-like protein SMT3 SMT3 D9719.15 YDR510W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY A2790DE7F315E1A7 A2790DE7F315E1A7 smc5_yeast Structural maintenance of chromosomes protein 5 SMC5 YOL034W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSLIDLGRYVERTHHGEDTEPRSKRVKIAKPDLSSFQPGSIIKIRLQDFVTYTLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFIKNGQDVSKIEITLKNSPNVTDIEYIDARDETIKITRIITRSKRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDASLLDVLDELRELQGNEQSLQKDLDFKKAKIVHLRQESDKLRKSVESLRDFQNKKGEIELHSQLLPYVKVKDHKEKLNIYKEEYERAKANLRAILKDKKPFANTKKTLENQVEELTEKCSLKTDEFLKAKEKINEIFEKLNTIRDEVIKKKNQNEYYRGRTKKLQATIISTKEDFLRSQEILAQTHLPEKSVFEDIDIKRKEIINKEGEIRDLISEIDAKANAINHEMRSIQRQAESKTKSLTTTDKIGILNQDQDLKEVRDAVLMVREHPEMKDKILEPPIMTVSAINAQFAAYLAQCVDYNTSKALTVVDSDSYKLFANPILDKFKVNLRELSSADTTPPVPAETVRDLGFEGYLSDFITGDKRVMKMLCQTSKIHTIPVSRRELTPAQIKKLITPRPNGKILFKRIIHGNRLVDIKQSAYGSKQVFPTDVSIKQTNFYQGSIMSNEQKIRIENEIINLKNEYNDRKSTLDALSNQKSGYRHELSELASKNDDINREAHQLNEIRKKYTMRKSTIETLREKLDQLKREARKDVSQKIKDIDDQIQQLLLKQRHLLSKMASSMKSLKNCQKELISTQILQFEAQNMDVSMNDVIGFFNEREADLKSQYEDKKKFVKEMRDTPEFQSWMREIRSYDQDTKEKLNKVAEKYEEEGNFNLSFVQDVLDKLESEIAMVNHDESAVTILDQVTAELRELEHTVPQQSKDLETIKAKLKEDHAVLEPKLDDIVSKISARFARLFNNVGSAGAVRLEKPKDYAEWKIEIMVKFRDNAPLKKLDSHTQSGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFLITPKLLTGLHYHEKMRIHCVMAGSWIPNPSEDPKMIHFGETSNYSFD 6752B96438CFB549 6752B96438CFB549 smc5-mph1-1 3 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association smc5-sumo-1 1 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association nse6-mph1-1 2 11 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mph1-smc5-1 6 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association smc5-mph1-2 4 13 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association smc5-mph1-3 5 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association smc5-mph1-4 7 13 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction smc6-mph1-1 8 9 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association