DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133941X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133947X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133950X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133939X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133952X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133944X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133949X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133942X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133948X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133946X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133937X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133940X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133938X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133951X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133943X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 2010 imex curation Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li T., Robert EI., van Breugel PC., Strubin M., Zheng N. DIP original experiment: DIP-133945X Nature structural & molecular biology 2010 IMEx A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. dcaf4_human DDB1- and CUL4-associated factor 4 DCAF4 WDR21 WDR21A WD repeat-containing protein 21A protein protein human Homo sapiens Human MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCFSTGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKATRLFHDSAVTSVRILQDEQYLMASDMAGKIKLWDLRTTKCVRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSLHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS DIP protein Q8WV16 original sequence version: 68 F104B7F1FC6B5C33 cul4a_human Cullin-4A CUL4A protein protein human Homo sapiens Human MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA DIP protein Q13619 original sequence version: 136 DIP protein Q13619 original sequence version: 131 DIP protein Q13619 original sequence version: 129 DIP protein Q13619 original sequence version: 87 DIP protein Q13619 original sequence version: 104 DIP protein Q13619 original sequence version: 151 DIP protein Q13619 original sequence version: 111 DIP protein Q13619 original sequence version: 140 3C4C6A1BBD94D51B q89246_9hepa Protein X X HBx Peptide X pX protein protein woodchuck hepatitis virus Woodchuck hepatitis virus MAARLCCHLDSARDVLLLRPFGPQSSGPPFPRPSAGSAASPASSLSTSDESDFPLGRLPACFASASGPCCLVFTCAELRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL DIP protein Q89246 original sequence version: 33 dcaf6_human DDB1- and CUL4-associated factor 6 DCAF6 IQWD1 Nuclear receptor interaction protein IQ motif and WD repeat-containing protein 1 Androgen receptor complex-associated protein MSTP055 protein protein human Homo sapiens Human MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRREFIQRLKLEATLNVHDGCVNTICWNDTGEYILSGSDDTKLVISNPYSRKVLTTIRSGHRANIFSAKFLPCTNDKQIVSCSGDGVIFYTNVEQDAETNRQCQFTCHYGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSCTKEDCKDDILINCRRAATSVAICPPIPYYLAVGCSDSSVRIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLNNKSCRVTSLCYSEDGQEILVSYSSDYIYLFDPKDDTARELKTPSAEERREELRQPPVKRLRLRGDWSDTGPRARPESERERDGEQSPNVSLMQRMSDMLSRWFEEASEVAQSNRGRGRSRPRGGTSQSDISTLPTVPSSPDLEVSETAMEVDTPAEQFLQPSTSSTMSAQAHSTSSPTESPHSTPLLSSPDSEQRQSVEASGHHTHHQSDNNNEKLSPKPGTGEPVLSLHYSTEGTTTSTIKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDVTKYQEGVSAENPVENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQFQTEATGPSAHEETSTRDSALQDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRKERKEMEELDTLNIRRPLVKMVYKGHRNSRTMIKEANFWGANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCLQPHPFDPILASSGIDYDIKIWSPLEESRIFNRKLADEVITRNELMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRSEGSGQENENEDEE DIP protein Q58WW2 original sequence version: 128 DIP protein Q58WW2 original sequence version: 54 8C7602D635DAF124 dca12_human DDB1- and CUL4-associated factor 12 DCAF12 KIAA1892 TCC52 WDR40A WD repeat-containing protein 40A Centrosome-related protein TCC52 Testis cancer centrosome-related protein protein protein human Homo sapiens Human MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFHLGTLNKVFASQWLNHRQVVCGTKCNTLFVVDVQTSQITKIPILKDREPGGVTQQGCGIHAIELNPSRTLLATGGDNPNSLAIYRLPTLDPVCVGDDGHKDWIFSIAWISDTMAVSGSRDGSMGLWEVTDDVLTKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKELGAVSLDGYFHLWKAENTLSKLLSTKLPYCRENVCLAYGSEWSVYAVGSQAHVSFLDPRQPSYNVKSVCSRERGSGIRSVSFYEHIITVGTGQGSLLFYDIRAQRFLEERLSACYGSKPRLAGENLKLTTGKGWLNHDETWRNYFSDIDFFPNAVYTHCYDSSGTKLFVAGGPLPSGLHGNYAGLWS DIP protein Q5T6F0 original sequence version: 51 07F3738BA6BB5355 q8n5d0-4 WD and tetratricopeptide repeats protein 1 WDTC1 KIAA1037 protein protein human Homo sapiens Human MAKVNITRDLIRRQIKERGALSFERRYHVTDPFIRRLGLEAELQGHSGCVNCLEWNEKGDLLASGSDDQHTIVWDPLHHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHDLTVKETIHMFGDHTNRVKRIATAPMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMKQSPSAGVHTFCDRQKPLPDGAAQYYVAGHLPVKLPDYNNRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTYKQRPYTFLLPRKCHSSGVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRGHVSPQVELPPYLERVKQQANEAFACQQWTQAIQLYSKAVQRAPHNAMLYGNRAAAYMKRKWDGDHYDALRDCLKAISLNPCHLKAHFRLARCLFELKYVAEALECLDDFKGKFPEQAHSSACDALGRDITAALFSKNDGEEKKGPGGGAPVRLRSTSRKDSISEDEMVLRERSYDYQFRYCGHCNTTTDIKEANFFGSNAQYIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTGRVVEDMEGASQANQRRMNADPLEVMLLNMGYRITGLSSGGAGASDDEDSSEGQVQCRPS DIP protein Q8N5D0-4 original sequence version: 76 No experimental confirmation available. ddb2_human DNA damage-binding protein 2 Damage-specific DNA-binding protein 2 DDB p48 subunit UV-damaged DNA-binding protein 2 DDB2 protein protein human Homo sapiens Human MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQEEARTRK DIP protein Q92466 original sequence version: 150 DIP protein Q92466 original sequence version: 145 DIP protein Q92466-1 original sequence version: 105 DIP protein Q92466-1 original sequence version: 120 DIP protein Q92466 original sequence version: 137 DIP protein Q92466 original sequence version: 142 E881F21242CA44D2 q8tel6-1 Short transient receptor potential channel 4-associated protein Protein TAP1 TNF-receptor ubiquitous scaffolding/signaling protein TRPC4AP C20orf188 TRRP4AP protein protein human Homo sapiens Human MAAAPVAAGSGAGRGRRSAATVAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQFTETFLTERDKQSKWSGIPQLLLKLHTTSHLHSDFVECQNILKEISPLLSMEAMAFVTEERKLTQETTYPNTYIFDLFGGVDLLVEILMRPTISIRGQKLKISDEMSKDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATLIEDILGVKKEMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGNDDKHTLLAKNAQQKKSLSLGPSAAEINQAALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMRVANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGKRGLLTRLLQVMKKEPAESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRCVTLSLDRFENQVDMKVAEVLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLVILMLARRKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQHYLHKDKDSTCLENSSCISFSYWKETVSILLNPDRQSPSALVSYIEEPYMDIDRDFTEE DIP protein Q8TEL6-1 original sequence version: 69 q9qmh9_hbv Protein X x X HBx Peptide X pX protein protein hbv Hepatitis B virus (HBV) HBV MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA DIP protein Q9QMH9 original sequence version: 29 dcaf8_human DDB1- and CUL4-associated factor 8 DCAF8 H326 WDR42A WD repeat-containing protein 42A protein protein human Homo sapiens Human MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERALEDWVSSETSALPRPRWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLHFNQRGTWLASGSDDLKVVVWDWVRRQPVLDFESGHKSNVFQAKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVAQHKGASHKLALEPDSPCTFLSAGEDAVVFTIDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVGGRDQFVRIYDQRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGTELLASYNDEDIYLFNSSHSDGAQYVKRYKGHRNNATVKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGVVNCLEPHPHLPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLFDSHMLWFLMHHLRQRRHHRRWREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPS DIP protein Q5TAQ9 original sequence version: 55 3F3396C77EA1E3AD v_piv5 Non-structural protein V P/V protein protein sv5 Simian virus 5 (strain W3) PIV5 Simian virus 5 MDPTDLSFSPDEINKLIETGLNTVEYFTSQQVTGTSSLGKNTIPPGVTGLLTNAAEAKIQESTNHQKGSVGGGAKPKKPRPKIAIVPADDKTVPGKPIPNPLLGLDSTPSTQTVLDLSGKTLPSGSYKGVKLAKFGKENLMTRFIEEPRENPIATSSPIDFKRGRDTGGFHRREYSIGWVGDEVKVTEWCNPSCSPITAAARRFECTCHQCPVTCSECERDT DIP protein P11207 original sequence version: 53 DIP protein P11207 original sequence version: 80 13D2F1627D15AFA3 dcaf5_human DDB1- and CUL4-associated factor 5 DCAF5 BCRG2 KIAA1824 WDR22 Breakpoint cluster region protein 2 WD repeat-containing protein 22 protein protein human Homo sapiens Human MKRRAGLGGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGCRNLYKKDLLGHFGCVNAIEFSNNGGQWLVSGGDDRRVLLWHMEQAIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPHGEPFCLANYPSAFHSVMFNPVEPRLLATANSKEGVGLWDIRKPQSSLLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWRIPADPEAGGIGRVVNGAFMVLKGHRSIVNQVRFNPHTYMICSSGVEKIIKIWSPYKQPGCTGDLDGRIEDDSRCLYTHEEYISLVLNSGSGLSHDYANQSVQEDPRMMAFFDSLVRREIEGWSSDSDSDLSESTILQLHAGVSERSGYTDSESSASLPRSPPPTVDESADNAFHLGPLRVTTTNTVASTPPTPTCEDAASRQQRLSALRRYQDKRLLALSNESDSEENVCEVELDTDLFPRPRSPSPEDESSSSSSSSSSEDEEELNERRASTWQRNAMRRRQKTTREDKPSAPIKPTNTYIGEDNYDYPQIKVDDLSSSPTSSPERSTSTLEIQPSRASPTSDIESVERKIYKAYKWLRYSYISYSNNKDGETSLVTGEADEGRAGTSHKDNPAPSSSKEACLNIAMAQRNQDLPPEGCSKDTFKEETPRTPSNGPGHEHSSHAWAEVPEGTSQDTGNSGSVEHPFETKKLNGKALSSRAEEPPSPPVPKASGSTLNSGSGNCPRTQSDDSEERSLETICANHNNGRLHPRPPHPHNNGQNLGELEVVAYSSPGHSDTDRDNSSLTGTLLHKDCCGSEMACETPNAGTREDPTDTPATDSSRAVHGHSGLKRQRIELEDTDSENSSSEKKLKT DIP protein Q96JK2 original sequence version: 70 3C627BA3FB2DC522 ddb1_human DNA damage-binding protein 1 DDB1 Damage-specific DNA-binding protein 1 UV-damaged DNA-binding factor DDB p127 subunit DNA damage-binding protein a UV-damaged DNA-binding protein 1 Xeroderma pigmentosum group E-complementing protein XPE-binding factor HBV X-associated protein 1 XAP1 protein protein human Homo sapiens Human MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH DIP protein Q16531 original sequence version: 145 DIP protein Q16531 original sequence version: 140 DIP protein Q16531 original sequence version: 99 DIP protein Q16531 original sequence version: 93 DIP protein Q16531 original sequence version: 116 DIP protein Q16531 original sequence version: 111 DIP protein Q16531-1 original sequence version: 163 DIP protein Q16531 original sequence version: 162 DIP protein Q16531 original sequence version: 113 DIP protein Q16531 original sequence version: 132 DIP protein Q16531 original sequence version: 139 DIP protein Q16531 original sequence version: 151 DIP protein Q16531-1 original sequence version: 144 DIP protein Q16531 original sequence version: 155 74D082023E3D846D x-ddb1-1 11 19 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey Q16531:p.[Ala381Glu;Phe382Asp] A381E/F382D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D certain certain sequence position certain certain certain sequence position certain A E This feature has been corrected as a result of our quality control procedures. The original label was 'A381E/F382D'. Wed May 02 19:32:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala381glu,phe382asp' Tue Jun 30 18:01:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala381Glu;Phe382Asp]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ddb1-wdtc1-1 10 22 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 5-17 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction ddb1-x-1 16 25 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 88-101 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction dcaf6-ddb1-1 3 20 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 9-21 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction x-ddb1-2 13 25 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey Q16531:p.[Ala381Glu;Phe382Asp] A381E/F382D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D certain certain sequence position certain certain certain sequence position certain A E This feature has been corrected as a result of our quality control procedures. The original label was 'A381E/F382D'. Wed May 02 17:27:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala381glu,phe382asp' Tue Jun 30 20:07:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala381Glu;Phe382Asp]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ddb1-cul4a-4 8 18 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q16531:p.[Ala400Asp;Trp561Lys;Ile587Asp;Arg589Glu] W561K/I587D/R589E/A400D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain I D certain certain sequence position certain certain certain sequence position certain W K certain certain sequence position certain certain certain sequence position certain A D This feature has been corrected as a result of our quality control procedures. The original label was 'W561K/I587D/R589E/A400D'. Wed May 02 18:25:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala400asp,trp561lys,ile587asp,arg589glu' Tue Jun 30 16:49:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala400Asp;Trp561Lys;Ile587Asp;Arg589Glu]' human Homo sapiens Human physical association physical association ddb1-ddb2-4 2 23 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 68-81 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction dcaf8-ddb1-1 14 26 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 153-165 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction p/v-ddb1-1 4 27 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey Q16531:p.[Ala381Glu;Phe382Asp] A381E/F382D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D certain certain sequence position certain certain certain sequence position certain A E This feature has been corrected as a result of our quality control procedures. The original label was 'A381E/F382D'. Wed May 02 14:52:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala381glu,phe382asp' Tue Jun 30 18:38:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala381Glu;Phe382Asp]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction trpc4ap-ddb1-1 15 24 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction dcaf4-ddb1-1 9 17 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 124-136 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction dcaf12-ddb1-1 5 21 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 45-57 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction wdtc1-ddb1-1 12 22 unspecified role unspecified role bait bait N-terminal domain Region 1-25 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 29 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction dcaf5-ddb1-1 7 28 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 13-25 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction ddb1-x-2 6 19 unspecified role unspecified role unspecified role unspecified role H-Box motif Region 86-99 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction x-cul4a-1 1 18 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role bait bait Q9QMH9:p.Arg96Glu R96E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R96E'. Wed May 02 17:03:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg96glu' Tue Jun 30 20:17:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg96Glu' GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association