DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215844X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215840X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215848X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215839X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215843X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215847X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215838X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215849X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215845X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215846X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215841X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215842X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. fgfr4_mouse Fibroblast growth factor receptor 4 Fgfr4 Fgfr-4 Mpk-11 Protein-tyrosine kinase receptor MPK-11 protein protein mouse Mus musculus Mouse MWLLLALLSIFQGTPALSLEASEEMEQEPCLAPILEQQEQVLTVALGQPVRLCCGRTERGRHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVVHNLTLLMDDSLTSISNDEDPKTLSSSSSGHVYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIHWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSSFGADGFPYVQVLKTTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDLTWTTATPEARYTDIILYVSGSLVLLVLLLLAGVYHRQVIRGHYSRQPVTIQKLSRFPLARQFSLESRSSGKSSLSLVRGVRLSSSGPPLLTGLVNLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFEILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPFSPSNGDASSTCSSSDSVFSHDPLPLEPSPFPFSDSQTT DIP protein Q03142 original sequence version: 145 DIP protein Q03142 original sequence version: 109 fgfr1_human Fibroblast growth factor receptor 1 FGFR1 FGFBR FLG FLT2 Fms-like tyrosine kinase 2 Proto-oncogene c-Fgr BFGFR CEK HBGFR Basic fibroblast growth factor receptor 1 N-sam protein protein human Homo sapiens Human MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR DIP protein P11362 original sequence version: 154 DIP protein P11362 original sequence version: 160 DIP protein P11362 original sequence version: 180 DIP protein P11362 original sequence version: 170 93A01B5D78C3E72C q61851-1 Fibroblast growth factor receptor 3 Fgfr3 Mfr3 Sam3 IIIc Heparin-binding growth factor receptor protein protein mouse Mus musculus Mouse MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHKVSRFPLKRQVSLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTPGGPSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSGDDSVFTHDLLPPGPPSNGGPRT DIP protein Q61851-1 original sequence version: 104 fgf23_human Fibroblast growth factor 23 FGF23 HYPF Phosphatonin Tumor-derived hypophosphatemia-inducing factor UNQ3027/PRO9828 protein protein human Homo sapiens Human MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI DIP protein Q9GZV9 original sequence version: 136 DIP protein Q9GZV9 original sequence version: 108 6093BD0CC50C2489 klot_mouse Klotho Kl protein protein mouse Mus musculus Mouse MLARAPPRRPPRLVLLRLLLLHLLLLALRARCLSAEPGQGAQTWARFARAPAPEAAGLLHDTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPSDSPIVVAPSGAPSPPLSSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGTAGTPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGRVSIALSSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYPESMKNNLSSLLPDFTESEKRLIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQLLSWIDLEYNHPPIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKELLPKSSALFYQKLIEDNGFPPLPENQPLEGTFPCDFAWGVVDNYVQVDTTLSQFTDPNVYLWDVHHSKRLIKVDGVVAKKRKPYCVDFSAIRPQITLLREMRVTHFRFSLDWALILPLGNQTQVNHTVLHFYRCMISELVHANITPVVALWQPAAPHQGLPHALAKHGAWENPHTALAFADYANLCFKELGHWVNLWITMNEPNTRNMTYRAGHHLLRAHALAWHLYDDKFRAAQKGKISIALQADWIEPACPFSQNDKEVAERVLEFDIGWLAEPIFGSGDYPRVMRDWLNQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYTTILVDWEKEDPMKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLRFKYGDLPMYVTANGIDDDPHAEQDSLRIYYIKNYVNEALKAYVLDDINLCGYFAYSLSDRSAPKSGFYRYAANQFEPKPSMKHYRKIIDSNGFLGSGTLGRFCPEEYTVCTECGFFQTRKSLLVFISFLVFTFIISLALIFHYSKKGQRSYK DIP protein O35082 original sequence version: 106 DIP protein O35082-1 original sequence version: 82 24BD772A1F81B8EC fgfr1_mouse Fibroblast growth factor receptor 1 Fgfr1 Flg Basic fibroblast growth factor receptor 1 MFR Proto-oncogene c-Fgr protein protein mouse Mus musculus Mouse MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR DIP protein P16092 original sequence version: 162 DIP protein P16092 original sequence version: 124 mint Receptor for basic fibroblast growth factor. A shorter form of the receptor could be a receptor for FGF1 (aFGF) homomint D5A4695FA680926B kl-fgfr1-1 7 17 unspecified role unspecified role bait bait Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 14 unspecified role unspecified role prey prey Ectodomain Region 142-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fgfr1-kl-3 6 18 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association fgfr3-kl-1 2 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 15 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association fgfr1-kl-4 1 17 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 14 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 142-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fgf23-fgfr1-1 12 16 unspecified role unspecified role bait bait Region 28-251 Region 28-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role prey prey Ectodomain Region 142-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fgfr3-fgf23-1 3 15 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human association association fgfr1-fgf23-2 4 18 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human association association fgf23-fgfr1-2 9 16 unspecified role unspecified role unspecified role unspecified role Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 14 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 142-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association fgf23-kl-2 5 17 unspecified role unspecified role prey prey Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 16 unspecified role unspecified role bait bait Region 28-251 Region 28-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kl-fgf23-2 10 17 unspecified role unspecified role bait bait Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 28-200 Region 28-200 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association fgfr4-kl-1 11 17 unspecified role unspecified role prey prey Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 13 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association fgfr4-fgf23-1 8 13 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human association association