DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216136X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216129X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216138X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216135X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216134X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216127X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216139X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216133X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216132X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216131X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216130X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216137X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216128X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tritschler F., Braun JE., Motz C., Igreja C., Haas G., Truffault V., Izaurralde E., Weichenrieder O. DIP original experiment: DIP-216140X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx DCP1 forms asymmetric trimers to assemble into active mRNA decapping complexes in metazoa. dcp1a_human mRNA-decapping enzyme 1A DCP1A Transcription factor SMIF Smad4-interacting transcriptional co-activator SMIF protein protein human Homo sapiens Human MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL DIP protein Q9NPI6 original sequence version: 76 DIP protein Q9NPI6 original sequence version: 96 DIP protein Q9NPI6 original sequence version: 120 26480D0B10CE7C72 ddx6_human Probable ATP-dependent RNA helicase DDX6 DDX6 HLR2 RCK DEAD box protein 6 ATP-dependent RNA helicase p54 Oncogene RCK protein protein human Homo sapiens Human MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP DIP protein P26196 original sequence version: 65 DIP protein P26196 original sequence version: 114 DIP protein P26196 original sequence version: 138 F802C642861793FB dcp1b_human mRNA-decapping enzyme 1B DCP1B protein protein human Homo sapiens Human MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQGTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVRSADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNASRTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGLAQPPQAYFNGSLPPQTVGHQAHGREQSTLPRQTLPISGSQTGSSGVISPQELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKPLESWINKTPNTEQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKERESGLLPVGGQEPPAAATSLLLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNIIYEAYLFSMTQAAMKKTM DIP protein Q8IZD4 original sequence version: 68 DIP protein Q8IZD4 original sequence version: 111 00B9D9592BAC3B64 edc4_human Enhancer of mRNA-decapping protein 4 Human enhancer of decapping large subunit Autoantigen Ge-1 Autoantigen RCD-8 EDC4 HEDLS protein protein human Homo sapiens Human MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVPDPLCSGDSTSANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVADLAFAHLNSPQLACLDEAGNLFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPFIPEESEDCCEESSPTVALLHEDRAEVWDLDMLRSSHSTWPVDVSQIKQGFIVVKGHSTCLSEGALSPDGTVLATASHDGYVKFWQIYIEGQDEPRCLHEWKPHDGRPLSCLLFCDNHKKQDPDVPFWRFLITGADQNRELKMWCTVSWTCLQTIRFSPDIFSSVSVPPSLKVCLDLSAEYLILSDVQRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAPLPTHTAHEDFTFGESRPELGSEGLGSAAHGSQPDLRRIVELPAPADFLSLSSETKPKLMTPDAFMTPSASLQQITASPSSSSSGSSSSSSSSSSSLTAVSAMSSTSAVDPSLTRPPEELTLSPKLQLDGSLTMSSSGSLQASPRGLLPGLLPAPADKLTPKGPGQVPTATSALSLELQEVEPLGLPQASPSRTRSPDVISSASTALSQDIPEIASEALSRGFGSSAPEGLEPDSMASAASALHLLSPRPRPGPELGPQLGLDGGPGDGDRHNTPSLLEAALTQEASTPDSQVWPTAPDITRETCSTLAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASASGGFGTKVPAPRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDWPALIWQQQRELAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDAIARAAADTLQGPMQAAYREAFQSVVLPAFEKSCQAMFQQINDSFRLGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQSATEQMAATVAGSVRAEVQHQLHVAVGSLQESILAQVQRIVKGEVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCETVDPAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP DIP protein Q6P2E9 original sequence version: 74 DIP protein Q6P2E9 original sequence version: 96 0790BB8ADF488356 dcp2_human m7GpppN-mRNA hydrolase Nucleoside diphosphate-linked moiety X motif 20 DCP2 NUDT20 mRNA-decapping enzyme 2 protein protein human Homo sapiens Human METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKNQSMRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL DIP protein Q8IU60 original sequence version: 72 DIP protein Q8IU60 original sequence version: 94 DIP protein Q8IU60 original sequence version: 95 C0FA503A0C797967 q9w1h5_drome DCP1 Dcp-1 Dcp1 Dcp1p Dmel\CG11183 anon-WO0118547.163 dDCP1 dDcp1 dcp-1 CG11183 Dmel_CG11183 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFLLYRNERSRIRGFWFYNSEECDRISGLVNGLLKSKDQGTNGQAQRHVSAPQQPKQDSSQPASIFNMLTKAQKDYNAQVSGGQPKTPSAENVTAGNVLKFFESAKQATAESLFHRVQPLSVDQLEKQQRAATPGEDLLPPAGRDNHESRLSPFQKMQQLNIQLLSDLKIGKSYATAQSPTVAPSSSALMANDDAGKCLRRLLAGDKPGPALMPPTMFDAPNNGNPEPQQPQQPQQPLLNSTQFVQAFTYLIQNDKEFANKLHKAYLNGCSNLLLDSSSTYQ DIP protein Q9W1H5 original sequence version: 72 6F46D235AB944254 edc3_human Enhancer of mRNA-decapping protein 3 YjeF domain-containing protein 1 LSM16 homolog EDC3 PP844 LSM16 YJDC YJEFN2 YjeF N-terminal domain-containing protein 2 protein protein human Homo sapiens Human MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKSYVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPLHSA DIP protein Q96F86 original sequence version: 75 95346F484FCFC3EA dcp1a-dcp1b-3 14 17 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association dcp1-1 8 20 unspecified role unspecified role unspecified role unspecified role Trimerization domain Region 328-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9W1H5:p.[Leu341Xaa;Phe348Xaa;Leu352Xaa] L341/F348/L352 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L X certain certain sequence position certain certain certain sequence position certain F X certain certain sequence position certain certain certain sequence position certain L X Wed May 02 19:03:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu341xaa,phe348xaa,leu352xaa' Tue Jun 30 17:06:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu341Xaa;Phe348Xaa;Leu352Xaa]' Q9W1H5:p.[Thr339Xaa;Ile342Xaa;Ala349Xaa] T339/I342/A349 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A X certain certain sequence position certain certain certain sequence position certain I X certain certain sequence position certain certain certain sequence position certain T X Wed May 02 16:29:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr339xaa,ile342xaa,ala349xaa' Tue Jun 30 15:41:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr339Xaa;Ile342Xaa;Ala349Xaa]' Q9W1H5:p.[Phe338Xaa;Ile342Xaa;Phe348Xaa;Leu352Xaa] F338/I342/F348/L352 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L X certain certain sequence position certain certain certain sequence position certain F X certain certain sequence position certain certain certain sequence position certain I X certain certain sequence position certain certain certain sequence position certain F X Wed May 02 16:54:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe338xaa,ile342xaa,phe348xaa,leu352xaa' Tue Jun 30 18:34:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe338Xaa;Ile342Xaa;Phe348Xaa;Leu352Xaa]' ecolx Escherichia coli direct interaction direct interaction dcp1a-1 6 15 unspecified role unspecified role unspecified role unspecified role Trimerization domain Region 539-582 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dcp1a-edc4-1 1 18 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NPI6:p.[Leu554Ser;Phe561Arg;Leu565Ser] L554S/F561R/L565S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L554S/F561R/L565S'. Wed May 02 20:28:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu554ser,phe561arg,leu565ser' Tue Jun 30 19:42:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu554Ser;Phe561Arg;Leu565Ser]' Q9NPI6:p.[Ile552Ser;Ile555Arg;Leu562Glu] I552S/I555R/L562E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain I R certain certain sequence position certain certain certain sequence position certain I S This feature has been corrected as a result of our quality control procedures. The original label was 'I552S/I555R/L562E'. Wed May 02 15:56:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile552ser,ile555arg,leu562glu' Tue Jun 30 18:32:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile552Ser;Ile555Arg;Leu562Glu]' Q9NPI6:p.[Leu551Arg;Ile555Ser;Phe561Arg;Leu565Ser] L551R/I555S/F561R/L565S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain I S certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L551R/I555S/F561R/L565S'. Wed May 02 19:21:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu551arg,ile555ser,phe561arg,leu565ser' Tue Jun 30 19:02:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu551Arg;Ile555Ser;Phe561Arg;Leu565Ser]' human Homo sapiens Human physical association physical association dcp1a-2 13 15 unspecified role unspecified role unspecified role unspecified role Trimerization domain Region 539-582 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dcp1a-dcp1a-2 5 15 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait Trimerization domain Region 539-582 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NPI6:p.[Leu554Ser;Phe561Arg;Leu565Ser] L554S/F561R/L565S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L554S/F561R/L565S'. Wed May 02 19:12:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu554ser,phe561arg,leu565ser' Tue Jun 30 17:33:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu554Ser;Phe561Arg;Leu565Ser]' Q9NPI6:p.[Ile552Ser;Ile555Arg;Leu562Glu] I552S/I555R/L562E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain I R certain certain sequence position certain certain certain sequence position certain I S This feature has been corrected as a result of our quality control procedures. The original label was 'I552S/I555R/L562E'. Wed May 02 16:26:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile552ser,ile555arg,leu562glu' Tue Jun 30 18:36:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile552Ser;Ile555Arg;Leu562Glu]' Q9NPI6:p.[Leu551Arg;Ile555Ser;Phe561Arg;Leu565Ser] L551R/I555S/F561R/L565S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain I S certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L551R/I555S/F561R/L565S'. Wed May 02 16:27:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu551arg,ile555ser,phe561arg,leu565ser' Tue Jun 30 19:51:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu551Arg;Ile555Ser;Phe561Arg;Leu565Ser]' human Homo sapiens Human physical association physical association dcp1a-3 2 15 unspecified role unspecified role unspecified role unspecified role Trimerization domain Region 539-582 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9NPI6:p.[Leu554Ser;Phe561Arg;Leu565Ser] L554S/F561R/L565S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L554S/F561R/L565S'. Wed May 02 19:57:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu554ser,phe561arg,leu565ser' Tue Jun 30 19:32:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu554Ser;Phe561Arg;Leu565Ser]' Q9NPI6:p.[Ile552Ser;Ile555Arg;Leu562Glu] I552S/I555R/L562E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain I R certain certain sequence position certain certain certain sequence position certain I S This feature has been corrected as a result of our quality control procedures. The original label was 'I552S/I555R/L562E'. Wed May 02 15:05:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile552ser,ile555arg,leu562glu' Tue Jun 30 17:40:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile552Ser;Ile555Arg;Leu562Glu]' Q9NPI6:p.[Leu551Arg;Ile555Ser;Phe561Arg;Leu565Ser] L551R/I555S/F561R/L565S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain I S certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L551R/I555S/F561R/L565S'. Wed May 02 20:30:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu551arg,ile555ser,phe561arg,leu565ser' Tue Jun 30 18:35:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu551Arg;Ile555Ser;Phe561Arg;Leu565Ser]' ecolx Escherichia coli direct interaction direct interaction dcp1a-dcp2-2 12 19 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NPI6:p.[Leu554Ser;Phe561Arg;Leu565Ser] L554S/F561R/L565S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L554S/F561R/L565S'. Wed May 02 15:36:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu554ser,phe561arg,leu565ser' Tue Jun 30 19:55:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu554Ser;Phe561Arg;Leu565Ser]' Q9NPI6:p.[Ile552Ser;Ile555Arg;Leu562Glu] I552S/I555R/L562E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain I R certain certain sequence position certain certain certain sequence position certain I S This feature has been corrected as a result of our quality control procedures. The original label was 'I552S/I555R/L562E'. Wed May 02 16:13:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile552ser,ile555arg,leu562glu' Tue Jun 30 19:26:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile552Ser;Ile555Arg;Leu562Glu]' Q9NPI6:p.[Leu551Arg;Ile555Ser;Phe561Arg;Leu565Ser] L551R/I555S/F561R/L565S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain I S certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain F R This feature has been corrected as a result of our quality control procedures. The original label was 'L551R/I555S/F561R/L565S'. Wed May 02 14:51:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu551arg,ile555ser,phe561arg,leu565ser' Tue Jun 30 15:39:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu551Arg;Ile555Ser;Phe561Arg;Leu565Ser]' human Homo sapiens Human physical association physical association dcp1a-4 11 15 unspecified role unspecified role unspecified role unspecified role Trimerization domain Region 539-582 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dcp1a-edc3-2 3 21 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association dcp1-dcp1-2 4 20 unspecified role unspecified role prey prey Trimerization domain Region 328-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 20 unspecified role unspecified role bait bait Trimerization domain Region 328-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association dcp1-2 10 20 unspecified role unspecified role unspecified role unspecified role Trimerization domain Region 328-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dcp1a-ddx6-3 7 16 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association dcp1-3 9 20 unspecified role unspecified role unspecified role unspecified role Trimerization domain Region 328-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction