DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216431X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216425X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216421X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216430X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216427X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216426X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216429X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216432X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216423X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216428X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216424X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216422X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. crkl_human Crk-like protein CRKL protein protein human Homo sapiens Human MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE DIP protein P46109 original sequence version: 64 DIP protein P46109 original sequence version: 103 DIP protein P46109 original sequence version: 104 DIP protein P46109 original sequence version: 156 294CF1EE2CD44B81 fyn_human Tyrosine-protein kinase Fyn p59-Fyn Proto-oncogene c-Fyn Src-like kinase FYN Proto-oncogene Syn protein protein human Homo sapiens Human MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL DIP protein P06241 original sequence version: 195 DIP protein P06241 original sequence version: 147 DIP protein P06241 original sequence version: 164 4A1E443A4B5A0977 btk_human Tyrosine-protein kinase BTK Bruton tyrosine kinase B-cell progenitor kinase BPK BTK AGMX1 ATK Agammaglobulinemia tyrosine kinase protein protein human Homo sapiens Human MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES DIP protein Q06187 original sequence version: 118 DIP protein Q06187 original sequence version: 143 DF06B5D1FEC257CC gpvi_human Platelet glycoprotein VI GP6 Glycoprotein 6 protein protein human Homo sapiens Human MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS DIP protein Q9HCN6 original sequence version: 75 3EFE2DD0E1676BA8 hck_human Tyrosine-protein kinase HCK HCK Hemopoietic cell kinase p59-HCK/p60-HCK Hematopoietic cell kinase p59Hck p61Hck protein protein human Homo sapiens Human MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP DIP protein P08631 original sequence version: 120 DIP protein P08631 original sequence version: 150 DIP protein P08631-1 original sequence version: 163 847E877A0A641725 yes_human Tyrosine-protein kinase Yes p61-Yes Proto-oncogene c-Yes YES1 YES protein protein human Homo sapiens Human MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL DIP protein P07947 original sequence version: 131 DIP protein P07947 original sequence version: 148 DIP protein P07947 original sequence version: 140 A2B376084686BBCD q9hcn6-1 Platelet glycoprotein VI GP6 Glycoprotein 6 VI-1 protein protein human Homo sapiens Human MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS DIP protein Q9HCN6-1 original sequence version: 75 lyn_human Tyrosine-protein kinase Lyn JTK8 Lck/Yes-related novel protein tyrosine kinase V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn LYN protein protein human Homo sapiens Human MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP DIP protein P07948 original sequence version: 141 408D3D461204E378 itsn1_human Intersectin-1 SH3 domain-containing protein 1A SH3P17 ITSN1 ITSN SH3D1A protein protein human Homo sapiens Human MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGIASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP DIP protein Q15811 original sequence version: 114 FC4DE644D8BEA2BE gp6-itsn1-1 8 21 unspecified role unspecified role prey prey SH3-3 domain Region 1002-1060 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association gp6-lyn-1 3 20 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association gp6-yes1-1 4 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role prey prey SH3 domain Region 91-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association gp6-lyn-2 6 20 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association gp6-fyn-1 11 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role prey prey SH3 domain Region 82-143 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association gp6-hck-1 10 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role prey prey SH3 domain Region 78-138 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association gp6-lyn-3 12 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 20 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association gp6-crkl-1 1 13 unspecified role unspecified role prey prey SH3 domain Region 123-296 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association gp6-fyn-2 2 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 14 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association gp6-btk-1 7 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role prey prey SH3 domain Region 214-274 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association gp6-fyn-3 9 20 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role bait bait human Homo sapiens Human association association gp6-lyn-4 5 19 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role prey prey SH3 domain Region 63-123 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association