DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134756X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134765X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134757X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134755X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134762X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134759X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134763X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134758X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134764X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134761X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pani B., Ong HL., Brazer SC., Liu X., Rauser K., Singh BB., Ambudkar IS. DIP original experiment: DIP-134760X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 trpc1_human Short transient receptor potential channel 1 TRPC1 TRP1 Transient receptor protein 1 protein protein human Homo sapiens Human MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN DIP protein P48995 original sequence version: 91 DIP protein P48995 original sequence version: 100 F4CC57ADDFA320AE stim1_human Stromal interaction molecule 1 STIM1 GOK protein protein human Homo sapiens Human MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK DIP protein Q13586 original sequence version: 141 DIP protein Q13586 original sequence version: 99 DIP protein Q13586 original sequence version: 108 DIP protein Q13586 original sequence version: 121 DIP protein Q13586 original sequence version: 125 DIP protein Q13586 original sequence version: 100 FFB5E7CB3D68A7A6 p48995-2 Short transient receptor potential channel 1 TRPC1 TRP1 Transient receptor protein 1 TRPC1A protein protein human Homo sapiens Human MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN DIP protein P48995-2 original sequence version: 91 C67F2053F8574122 stim1-trpc1-1 4 13 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association trpc1-cav1-1 2 12 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human association association trpc1-stim1-1 11 13 unspecified role unspecified role bait bait human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association trpc1-cav1-2 9 15 unspecified role unspecified role bait bait human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cav1-trpc1-1 1 12 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction stim1-cav1-1 8 12 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait human Homo sapiens Human association association cav1-trpc1-2 5 12 unspecified role unspecified role bait bait human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association trpc1-cav1-3 7 12 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cav1-stim1-1 10 12 unspecified role unspecified role bait bait human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human association association trpc1-cav1-4 3 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait Region 317-347 Region 317-347 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction trpc1-cav1-5 6 12 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human association association