DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu X-ray structure of Pur-alpha reveals a Whirly-like fold and an unusual nucleic-acid binding surface. X-ray structure of Pur-alpha reveals a Whirly-like fold and an unusual nucleic-acid binding surface. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Graebsch A., Roche S., Niessing D. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Graebsch A., Roche S., Niessing D. DIP original experiment: DIP-134703X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx X-ray structure of Pur-alpha reveals a Whirly-like fold and an unusual nucleic-acid binding surface. X-ray structure of Pur-alpha reveals a Whirly-like fold and an unusual nucleic-acid binding surface. X-ray structure of Pur-alpha reveals a Whirly-like fold and an unusual nucleic-acid binding surface. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Graebsch A., Roche S., Niessing D. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Graebsch A., Roche S., Niessing D. DIP original experiment: DIP-134704X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx X-ray structure of Pur-alpha reveals a Whirly-like fold and an unusual nucleic-acid binding surface. q95rr6_drome purA CG1507 Dmel_CG1507 Pur-alpha Dmel\CG1507 PURalpha Pur alpha Pur-a dPur alpha pur-alpha protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK DIP protein Q95RR6 original sequence version: 47 pur_alpha-1 1 3 unspecified role unspecified role unspecified role unspecified role PUR- I-III domain Region 40-255 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pur_alpha-2 2 3 unspecified role unspecified role unspecified role unspecified role PUR- I-III domain Region 40-255 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction