DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. PLoS biology 2009 imex curation Huang D., Kaluarachchi S., van Dyk D., Friesen H., Sopko R., Ye W., Bastajian N., Moffat J., Sassi H., Costanzo M., Andrews BJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Huang D., Kaluarachchi S., van Dyk D., Friesen H., Sopko R., Ye W., Bastajian N., Moffat J., Sassi H., Costanzo M., Andrews BJ. DIP original experiment: DIP-132678X PLoS biology 2009 IMEx Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. PLoS biology 2009 imex curation Huang D., Kaluarachchi S., van Dyk D., Friesen H., Sopko R., Ye W., Bastajian N., Moffat J., Sassi H., Costanzo M., Andrews BJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Huang D., Kaluarachchi S., van Dyk D., Friesen H., Sopko R., Ye W., Bastajian N., Moffat J., Sassi H., Costanzo M., Andrews BJ. DIP original experiment: DIP-132676X PLoS biology 2009 IMEx Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. PLoS biology 2009 imex curation Huang D., Kaluarachchi S., van Dyk D., Friesen H., Sopko R., Ye W., Bastajian N., Moffat J., Sassi H., Costanzo M., Andrews BJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Huang D., Kaluarachchi S., van Dyk D., Friesen H., Sopko R., Ye W., Bastajian N., Moffat J., Sassi H., Costanzo M., Andrews BJ. DIP original experiment: DIP-132679X PLoS biology 2009 IMEx Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. PLoS biology 2009 imex curation Huang D., Kaluarachchi S., van Dyk D., Friesen H., Sopko R., Ye W., Bastajian N., Moffat J., Sassi H., Costanzo M., Andrews BJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Huang D., Kaluarachchi S., van Dyk D., Friesen H., Sopko R., Ye W., Bastajian N., Moffat J., Sassi H., Costanzo M., Andrews BJ. DIP original experiment: DIP-132677X PLoS biology 2009 IMEx Dual regulation by pairs of cyclin-dependent protein kinases and histone deacetylases controls G1 transcription in budding yeast. rpd3_yeast Histone deacetylase RPD3 RPD3 SDI2 YNL330C N0305 MOF6 REC3 SDS6 Transcriptional regulatory protein RPD3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDYKLSVRPSNMFNVNTPEYLDKVMTNIFANLENTKYAPSVQLNHTPRDAEDLGDVEEDSAEAKDTKGGSQYARDLHVEHDNEFY 34FFD72A7E7425DB 34FFD72A7E7425DB pcl9_yeast PHO85 cyclin-9 PCL9 D1408 YDL179W protein protein yeast Saccharomyces cerevisiae Baker's yeast MISDYDALLQFNKKPVSQEMIQFLATSTASIIKIRENNNPIQGCRPPDLSIFIKNVVIQSNVQTPTLMATSVYLNKLKSVIPKNVYGINTTRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDVRITTPDLIDSLSYFLGPIKEQLFLQRRQEMLLFNAPSPGQLKEYINHRRPVSHSRTSSAISVPSLTSMATVSTTDSRSSLLAKYQPSLPLVESDNFNKKNHVPLRNNNDICNNFRAEENIHSVNHIDVTMGSSPVMSHKPTIHQRLNFTRRGWSSFFKQ 183820067EC00D23 183820067EC00D23 whi5_yeast G1-specific transcriptional repressor WHI5 WHI5 YOR3116W YOR083W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLRTPKRSRTSDEQEQEQEQEQVQNPDTHVNNEHQQRPGPTTLLSTPVRLKNGFGTPSPPSPPGITKSITKSRRRPSTTSLQGIFMSPVNKRRVGITAHGRVYDHNDDGHESESEDDENEEENENQKKYDGHVSMPLLPPTTPKSRRSEVFLSPSPRLRSPPTAARRSTGERPIREISHTLRTRLNYALVKLQNGWTDKTLPELETELAPAVQTPPRRYHNRFPDSADAGTSAHTAFLQALGGHPPREEATAVETLMLLSSPTKKQQHRPVPATSAGEPTDETEPESDTEVETS 013A41AC5DC1975F 013A41AC5DC1975F hos1_yeast Histone deacetylase HOS1 YP9499.23C YPR068C HOS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKLVISTSIFQSQVADLLPCNNHQKSQLTYSLINAYDLLQHFDEVLTFPYARKDDLLEFHSKSYIDYLINGRFNKMMAQDVNNPMVESKWSELSELADNWNEKIDYNPSQDLQRFTTRENLYNYYLNHSQALENNMDCINNSEVPTNDKPTDTYILNSETKQYNLEGDCPIFSYLPMYCQVITGATLNLLDHLSPTERLIGINWDGGRHHAFKQRASGFCYINDVVLLIQRLRKAKLNKITYVDFDLHHGDGVEKAFQYSKQIQTISVHLYEPGFFPGTGSLSDSRKDKNVVNIPLKHGCDDNYLELIASKIVNPLIERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYNDLLMSRFYTYLTWCVTKQFSNLRCGDNNSFQIDPFDVCDGDDSEQFIREHDLVEMYNEENYQYWIYEMEGSSRMKMLRNDNKDRDMVELMKFYEL 5DCFF35D8F6AC87D 5DCFF35D8F6AC87D hos3_yeast Histone deacetylase HOS3 LPH11W YPL116W HOS3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSKHSDPLERFYKQFQAFVQNNPNVISAARAAAQIPESAKAVVVLSPYSLQHVFPREWVTKSYRKTIVERPERLLASSMGISAAITMYPSLFTLKSSHQRKGSLMAPHVLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETGVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTYNVTHVVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFFRSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAICSGVFAHLIGLQNQDWVKEWGSEQVVKEIVRGCKPAWKPYKTKRAKDVIRIWAEEVIRLGRAMIPEFDDIIFKDAVNSAPSNSLLKATVEPASTSTIAQRIIRSHRSNASPEKELHENKPRSTEKQEQREIRSDTKVKQLSSNNRAAETQIPFLQQEFSSEDEDEEYVYDEELNKTFNRTVEDITIDDISRHLETLEIEKKGDEDSDHELKEKNWKNSHQRRLQGNGMYKIPSNTKPHRIRQPQNANTPTYDDSDISMISHVSRKHTTRSGGRW F2B5D09E87B097E5 F2B5D09E87B097E5 whi5-hos3-1 1 9 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association whi5-pcl9-1 2 6 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association whi5-rpd3-1 3 5 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association whi5-hos1-1 4 8 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association