DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Biogenesis of glutaminyl-mt tRNAGln in human mitochondria. Biogenesis of glutaminyl-mt tRNAGln in human mitochondria. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T. DIP original experiment: DIP-134538X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Biogenesis of glutaminyl-mt tRNAGln in human mitochondria. Biogenesis of glutaminyl-mt tRNAGln in human mitochondria. Biogenesis of glutaminyl-mt tRNAGln in human mitochondria. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T. DIP original experiment: DIP-134539X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Biogenesis of glutaminyl-mt tRNAGln in human mitochondria. gatc_human Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial 15E1.2 Protein 15E1.2 GATC protein protein human Homo sapiens Human MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS DIP protein O43716 original sequence version: 60 113118E9507234E4 gata_human Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial QRSL1 Glutaminyl-tRNA synthase-like protein 1 protein protein human Homo sapiens Human MLGRSLREVSAALKQGQITPTELCQKCLSLIKKTKFLNAYITVSEEVALKQAEESEKRYKNGQSLGDLDGIPIAVKDNFSTSGIETTCASNMLKGYIPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKNPWSYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGFKPSYGLVSRHGLIPLVNSMDVPGILTRCVDDAAIVLGALAGPDPRDSTTVHEPINKPFMLPSLADVSKLCIGIPKEYLVPELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHRCDIDVSTEAMYAATRREGFNDVVRGRILSGNFFLLKENYENYFVKAQKVRRLIANDFVNAFNSGVDVLLTPTTLSEAVPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLLTVAKWFEKQVQFPVIQLQELMDDCSAVLENEKLASVSLKQ DIP protein Q9H0R6 original sequence version: 61 06E21A7D17A6E963 gatb_human Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial GATB Cytochrome c oxidase assembly factor PET112 homolog PET112 PET112L HSPC199 protein protein human Homo sapiens Human MAAPMLRWGCRGRRWAFARVDGGSCHRRGAPTGSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLIYGVCAGKKQSQVIPKTVRIKQIQLEQDSGKSLHDNLRSQTLIDLNRAGVGLLEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSIRFLAKAIDYEIQRQINELENGGEILNETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADPQQVINIDQIRETLPELPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPKKVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSSAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLSL DIP protein O75879 original sequence version: 81 449EB3EA2FD4769D gatb-gatc-2 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association gatc-qrsl1-1 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction