DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu MEIG1 is essential for spermiogenesis in mice. MEIG1 is essential for spermiogenesis in mice. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Zhang Z., Shen X., Gude DR., Wilkinson BM., Justice MJ., Flickinger CJ., Herr JC., Eddy EM., Strauss JF. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Zhang Z., Shen X., Gude DR., Wilkinson BM., Justice MJ., Flickinger CJ., Herr JC., Eddy EM., Strauss JF. DIP original experiment: DIP-134584X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx MEIG1 is essential for spermiogenesis in mice. MEIG1 is essential for spermiogenesis in mice. MEIG1 is essential for spermiogenesis in mice. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Zhang Z., Shen X., Gude DR., Wilkinson BM., Justice MJ., Flickinger CJ., Herr JC., Eddy EM., Strauss JF. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhang Z., Shen X., Gude DR., Wilkinson BM., Justice MJ., Flickinger CJ., Herr JC., Eddy EM., Strauss JF. DIP original experiment: DIP-134583X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx MEIG1 is essential for spermiogenesis in mice. MEIG1 is essential for spermiogenesis in mice. MEIG1 is essential for spermiogenesis in mice. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Zhang Z., Shen X., Gude DR., Wilkinson BM., Justice MJ., Flickinger CJ., Herr JC., Eddy EM., Strauss JF. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhang Z., Shen X., Gude DR., Wilkinson BM., Justice MJ., Flickinger CJ., Herr JC., Eddy EM., Strauss JF. DIP original experiment: DIP-134582X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx MEIG1 is essential for spermiogenesis in mice. pacrg_mouse Parkin coregulated gene protein homolog Pacrg Hypertension-related protein 1-like protein PARK2 coregulated gene protein protein protein mouse Mus musculus Mouse MPKRTKLLPQQTFQVHQPRSLVSEGFTVKAMMKNSVVRGPPVAGAFKERPAKPTTFRKCYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLSEMTFPYEFFARRGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQIICVTLKVLQHLVVSSEMVGEALLPYYRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYESCLLN DIP protein Q9DAK2 original sequence version: 46 mint C871D590AA773AC1 meig1_mouse Meiosis-expressed gene 1 protein Meig1 Meg1 Protein expressed in male leptotene and zygotene spermatocytes 278 protein protein mouse Mus musculus Mouse MATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY DIP protein Q61845 original sequence version: 58 meig1-pacrg-1 3 4 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 5 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association meig1-pacrg-2 2 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction pacrg-meig1-1 1 4 unspecified role unspecified role bait bait mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association