DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin. JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin. Nature 2009 imex curation Dawson MA., Bannister AJ., Göttgens B., Foster SD., Bartke T., Green AR., Kouzarides T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dawson MA., Bannister AJ., Göttgens B., Foster SD., Bartke T., Green AR., Kouzarides T. DIP original experiment: DIP-219556X Nature 2009 IMEx JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin. JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin. JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin. Nature 2009 imex curation Dawson MA., Bannister AJ., Göttgens B., Foster SD., Bartke T., Green AR., Kouzarides T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dawson MA., Bannister AJ., Göttgens B., Foster SD., Bartke T., Green AR., Kouzarides T. DIP original experiment: DIP-219557X Nature 2009 IMEx JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin. cbx5_human Chromobox protein homolog 5 CBX5 Heterochromatin protein 1 homolog alpha Antigen p25 HP1A protein protein human Homo sapiens Human MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS DIP protein P45973 original sequence version: 138 DIP protein P45973 original sequence version: 116 DIP protein P45973 original sequence version: 115 DIP protein P45973 original sequence version: 124 DIP protein P45973 original sequence version: 154 DIP protein P45973 original sequence version: 132 DIP protein P45973 original sequence version: 155 16FFC476367093B1 h3(3156) Histone 3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) HATGGVKKPHRYRPGTVALREIRRYQK cbx5_mouse Chromobox protein homolog 5 Cbx5 Hp1a Heterochromatin protein 1 homolog alpha protein protein mouse Mus musculus Mouse MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESAKS DIP protein Q61686 original sequence version: 105 DIP protein Q61686 original sequence version: 91 DIP protein Q61686 original sequence version: 107 8AB87E2F00DB8C40 h3(3156)-cbx5-1 1 4 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro 5 unspecified role unspecified role prey prey Region 110-188 Region 110-188 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction h3(3156)-cbx5-2 2 3 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro physical association physical association