DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cleavage of RseA by RseP requires a carboxyl-terminal hydrophobic amino acid following DegS cleavage. Cleavage of RseA by RseP requires a carboxyl-terminal hydrophobic amino acid following DegS cleavage. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Li X., Wang B., Feng L., Kang H., Qi Y., Wang J., Shi Y. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Li X., Wang B., Feng L., Kang H., Qi Y., Wang J., Shi Y. DIP original experiment: DIP-134473X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Cleavage of RseA by RseP requires a carboxyl-terminal hydrophobic amino acid following DegS cleavage. Cleavage of RseA by RseP requires a carboxyl-terminal hydrophobic amino acid following DegS cleavage. Cleavage of RseA by RseP requires a carboxyl-terminal hydrophobic amino acid following DegS cleavage. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Li X., Wang B., Feng L., Kang H., Qi Y., Wang J., Shi Y. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Li X., Wang B., Feng L., Kang H., Qi Y., Wang J., Shi Y. DIP original experiment: DIP-134472X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Cleavage of RseA by RseP requires a carboxyl-terminal hydrophobic amino acid following DegS cleavage. rsea_ecoli Anti-sigma-E factor RseA yfiJ rseA mclA b2572 JW2556 Regulator of SigE Sigma-E anti-sigma factor RseA Sigma-E factor negative regulatory protein protein protein ecoli Escherichia coli (strain K12) MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ DIP protein P0AFX7 original sequence version: 71 DIP protein P0AFX7 original sequence version: 40 DIP protein P0AFX7 original sequence version: 39 DIP protein P0AFX7 original sequence version: 76 63BD12131C611C32 rsep_ecoli Regulator of sigma-E protease RseP ecfE yaeL rseP b0176 JW0171 S2P endopeptidase Site-2 protease RseP Site-2-type intramembrane protease protein protein ecoli Escherichia coli (strain K12) MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPVLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL DIP protein P0AEH1 original sequence version: 49 81A93BC113FBB66C degs_ecoli Serine endoprotease DegS degS hhoB htrH b3235 JW3204 Site-1 protease DegS Site-1-type intramembrane protease protein protein ecoli Escherichia coli (strain K12) MFVKLLRSVAIGLIVGAILLVAMPSLRSLNPLSTPQFDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN DIP protein P0AEE3 original sequence version: 45 DIP protein P0AEE3 original sequence version: 43 DIP protein P0AEE3 original sequence version: 85 D091B4D65E8FE1CC rsea-rsep-1 2 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 3 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-148 Region 1-148 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli cleavage cleavage reaction cleavage degs-rsea-5 1 5 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 3 enzyme target enzyme target substrate substrate unspecified role unspecified role P0AFX7:p.Val148Glu V148/E/D/P/G/F mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E Wed May 02 15:58:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val148glu' Tue Jun 30 18:51:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val148Glu' P0AFX7:p.Val148Asp mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain V D Wed May 02 20:09:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val148asp' Tue Jun 30 19:01:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val148Asp' P0AFX7:p.Val148Pro mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain V P Wed May 02 19:02:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val148pro' Tue Jun 30 17:54:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val148Pro' P0AFX7:p.Val148Gly mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain V G Wed May 02 16:18:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val148gly' Tue Jun 30 19:08:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val148Gly' P0AFX7:p.Val148Phe mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain V F Wed May 02 15:53:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val148phe' Tue Jun 30 17:47:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val148Phe' ecolx Escherichia coli cleavage cleavage reaction cleavage