DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Song J., Bishop BL., Li G., Grady R., Stapleton A., Abraham SN. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Song J., Bishop BL., Li G., Grady R., Stapleton A., Abraham SN. DIP original experiment: DIP-134471X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Song J., Bishop BL., Li G., Grady R., Stapleton A., Abraham SN. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Song J., Bishop BL., Li G., Grady R., Stapleton A., Abraham SN. DIP original experiment: DIP-134468X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Song J., Bishop BL., Li G., Grady R., Stapleton A., Abraham SN. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Song J., Bishop BL., Li G., Grady R., Stapleton A., Abraham SN. DIP original experiment: DIP-134469X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Song J., Bishop BL., Li G., Grady R., Stapleton A., Abraham SN. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Song J., Bishop BL., Li G., Grady R., Stapleton A., Abraham SN. DIP original experiment: DIP-134470X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx TLR4-mediated expulsion of bacteria from infected bladder epithelial cells. rb27b_human Ras-related protein Rab-27B RAB27B C25KG protein protein human Homo sapiens Human MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC DIP protein O00194 original sequence version: 100 8ED640F0C15EDCD3 cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 myrip_human Rab effector MyRIP MYRIP SLAC2C Myosin-VIIa- and Rab-interacting protein Exophilin-8 Synaptotagmin-like protein lacking C2 domains C protein protein human Homo sapiens Human MGRKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKNLYRKHRLESGACFDILGGSLFESNLENEGSISGSDSTFYRQSEGHSVMDTLAVALRVAEEAIEEAISKAEAYGDSLDKQNEASYLRDHKEELTEELATTILQKIIRKQKSKSEQQVEEEPGWPHPQSCSTKVADEGTSASPGGYRAPAALWRSQSAFSITGEEALKTPPVEAPSRQPRDQGQHPRAESALPSWKSVDRLDETNLAPVLQSPDGNWVALKDGAPPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSRALPRNPQPQPTQAQSSDQGPIAASPSSALSPNPEAMCSDSETSSAGSSREVGHQARLSWLQRKAPRNPAAEKMRLHGELDVNFNPQLASRETSDSSEPEEAPHTTDRRARRWRRARLGSEEPSKEPSSPSAQLRDLDTHQVSDDLSETDISNEARDPQTLTDTTEEKRRNRLYELAMKMSEKETSSGEDQESEPKTESENQKESLSSEDNSQSVQEELKKKFSAVSLCNISTEVLKVINATEELIAGSTGPWESPQVPPDRQKGMFPRGTDQVRLDEQLTSLEENVYLAAGTVYGLETQLTELEDAARCIHSGTDETHLADLEDQVATAAAQVHHAELQISDIESRISALTIAGLNIAPCVRFTRRRDQKQRTQVQTIDTSRQQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKERKGTTKDLMEPALESAVMY DIP protein Q8NFW9 original sequence version: 71 C1087932C405DFDD kap2_human cAMP-dependent protein kinase type II-alpha regulatory subunit PKR2 PRKAR2 PRKAR2A protein protein human Homo sapiens Human MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ DIP protein P13861 original sequence version: 107 DIP protein P13861 original sequence version: 128 C7D6E8E476E1DB65 rab27b-cav1-1 2 6 unspecified role unspecified role prey prey human Homo sapiens Human 5 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association prkar2a-cav1-1 1 6 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association rab27b-cav1-2 3 6 unspecified role unspecified role prey prey human Homo sapiens Human 5 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association myrip-cav1-1 4 6 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association