DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216099X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216098X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216095X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216097X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216096X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216100X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. q2idh1_anade Adeh_2858 protein protein anade Anaeromyxobacter dehalogenans (strain 2CP-C) MIRVVTLDPVDPTDMAALIRTLYQAFGLGTEFAGEKPVPAEAEGKDGRLDAITLLREVEPVRTFADDKVLYIAGAPLSLPPGPLGEPPCWGFADYGKERAVITTAKLPARGVTEASIETYRRRLAREAIHAIGHLWDLHHCVDARCAMHPSWSPSLAANPDSDLCTFCREKSERKIRLAKT DIP protein Q2IDH1 original sequence version: 18 q50887_myxxa carD HK404_15535 protein protein myxxa Myxococcus xanthus MPEGSASLQLAVGDRVVYPNQGVCRVSAIDVKEVAGQKLTFVTMRREEDGAVVMVPEGKVLAIGVRKVASAEDVEAIFTFLRSDSDKADLDWKQRARTNLDRMTQGGIMGLAEVVKGLQVLSELRPLPTKERELYDNARHLLVTEVAAALGTAEVNAEDAIDIVLFPPGRERPKRTAAEFQREEGDLDLDSDLLGLDSDLDLPSDEEPSEPSEEESSEEGESEEAASSEESAPKKRGRPPKAKTEAPEGAEPPAPKKRGRPPKPKPEATAEGAEPPAPKKRGRPPKPKPPEVEGAAPAAPKKRGRPPKVKPPEGES DIP protein Q50887 original sequence version: 39 q50888_myxxa BHS06_26425 carG HK404_15530 protein protein myxxa Myxococcus xanthus MIRVVTLDPFDDKQLAKFNRTLYTAFGVGSEHSDSVEVPAGMSEPLDAEKLIDEVKGIRSYKDDKVLLLTTRKLKDRELPSGVAPTAGFARQGKDRAILTIAPHKDLESAFKAVSRHALHQLGHLWELHHCLDPRCSMYPPWTPSFAQGEAIFCTFCREKSEQKIRLAKS DIP protein Q50888 original sequence version: 22 q2idh2_anade Adeh_2857 protein protein anade Anaeromyxobacter dehalogenans (strain 2CP-C) MRGPPARHPNDDAREQLPAPEGIIGIADELKPGDRVVYPNQGVCAVVGWEVKDIAGQKLELVRMTREEDGAAVMVPKGKVPSIGLRRVATGAQMEGVFHYLGAVYDDPELDWKIRHRDNADRLIAGGVLGVAEVVKGLHSLSRLRPLPTKEREQYDNARHLLVHEVSVSLAVPPGLAEDYIDYALMPPAGVKFDLKPPPAPVPLPSRPKKRRVVEEAEEGDLGLGDLGLGDLGIDLEGALEGAEVPGAEAEGAEGAEAGEGEAAGAEGVEAIPGVEEAAPEELPEAEEPVAEEEPEELPVRAPRAAKPARTAEKPGKVEKPEKAAEKKAARPAKPKKAEPEKPAKVEKHAEKPAARKAAAEKPAPAKKAAAKKPAAPKKAPAKKPAAEKPAAKRGGKKK DIP protein Q2IDH2 original sequence version: 14 card-carg-1 3 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction card-1 2 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q2idh1_anade-q2idh2_anade-1 5 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-210 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction card-carg-2 1 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q2idh2_anade-1 6 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q2idh1_anade-q2idh2_anade-2 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction