DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216008X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216015X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions ecolx Escherichia coli bn-page blue native page bn-page predetermined predetermined participant predetermined Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216010X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions ecolx Escherichia coli bn-page blue native page bn-page predetermined predetermined participant predetermined Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216016X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216011X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216012X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216014X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions in vitro In vitro bn-page blue native page bn-page predetermined predetermined participant predetermined Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216017X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216009X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Tarry MJ., Schäfer E., Chen S., Buchanan G., Greene NP., Lea SM., Palmer T., Saibil HR., Berks BC. DIP original experiment: DIP-216013X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural analysis of substrate binding by the TatBC component of the twin-arginine protein transport system. cueo_ecoli Blue copper oxidase CueO cueO b0123 JW0119 yacK Copper efflux oxidase protein protein ecoli Escherichia coli (strain K12) MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV DIP protein P36649 original sequence version: 103 37D96B1C331CF30B tatb_ecoli Sec-independent protein translocase protein TatB tatB mttA2 ysgB b3838 JW5580 protein protein ecoli Escherichia coli (strain K12) MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKASDEAHTIHNPVVKDNEAAHEGVTPAAAQTQASSPEQKPETTPEPVVKPAADAEPKTAAPSPSSSDKP DIP protein P69425 original sequence version: 44 31F1405404F5DABF ftsp_ecoli Cell division protein FtsP ftsP sufI JW2985 b3017 protein protein ecoli Escherichia coli (strain K12) MSLSRRQFIQASGIALCAGAVPLKASAAGQQQPLPVPPLLESRRGQPLFMTVQRAHWSFTPGTRASVWGINGRYLGPTIRVWKGDDVKLIYSNRLTENVSMTVAGLQVPGPLMGGPARMMSPNADWAPVLPIRQNAATLWYHANTPNRTAQQVYNGLAGMWLVEDEVSKSLPIPNHYGVDDFPVIIQDKRLDNFGTPEYNEPGSGGFVGDTLLVNGVQSPYVEVSRGWVRLRLLNASNSRRYQLQMNDGRPLHVISGDQGFLPAPVSVKQLSLAPGERREILVDMSNGDEVSITCGEAASIVDRIRGFFEPSSILVSTLVLTLRPTGLLPLVTDSLPMRLLPTEIMAGSPIRSRDISLGDDPGINGQLWDVNRIDVTAQQGTWERWTVRADEPQAFHIEGVMFQIRNVNGAMPFPEDRGWKDTVWVDGQVELLVYFGQPSWAHFPFYFNSQTLEMADRGSIGQLLVNPVP DIP protein P26648 original sequence version: 84 C843A5A4CB146688 tatc_ecoli Sec-independent protein translocase protein TatC tatC mttB yigU yigV b3839 JW3815 protein protein ecoli Escherichia coli (strain K12) MSVEDTQPLITHLIELRKRLLNCIIAVIVIFLCLVYFANDIYHLVSAPLIKQLPQGSTMIATDVASPFFTPIKLTFMVSLILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEIGVFFSRFYVGKGRNREEENDAEAESEKTEE DIP protein P69423 original sequence version: 49 D2383F85AF62A81C cueo-tatb-1 8 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association ftsp-tatb-1 1 14 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli 13 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli association association ftsp-tatb-2 3 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association ftsp-tatb-3 6 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association ftsp-tatb-4 9 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association tatc-tatb-1 5 14 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association tatb-tatc-4 10 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tatb-tatc-5 2 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cueo-tatb-2 7 11 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 14 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli association association tatb-tatc-6 4 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction