DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216082X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions bovin Bos taurus (Bovine) Bovine tem transmission electron microscopy tem predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216093X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216086X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions bovin Bos taurus (Bovine) Bovine solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216089X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216083X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216087X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216088X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216079X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216092X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions bovin Bos taurus (Bovine) Bovine dls dynamic light scattering dls predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216085X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216080X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216090X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216094X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216091X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216084X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. The eye lens chaperone alpha-crystallin forms defined globular assemblies. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. Only protein-protein interactions bovin Bos taurus (Bovine) Bovine molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Peschek J., Braun N., Franzmann TM., Georgalis Y., Haslbeck M., Weinkauf S., Buchner J. DIP original experiment: DIP-216081X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The eye lens chaperone alpha-crystallin forms defined globular assemblies. cryab_human Alpha-crystallin B chain CRYAB CRYA2 Renal carcinoma antigen NY-REN-27 Alpha(B)-crystallin Rosenthal fiber component Heat shock protein beta-5 HSPB5 protein protein human Homo sapiens Human MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK DIP protein P02511 original sequence version: null AE08BED46B7849CB DIP protein P02511 original sequence version: 195 DIP protein P02511 original sequence version: 130 DIP protein P02511 original sequence version: 131 DIP protein P02511 original sequence version: 151 DIP protein P02511 original sequence version: 167 DIP protein P02511 original sequence version: 154 DIP protein P02511 original sequence version: 146 AE08BED46B7849CB cryaa_human Alpha-crystallin A chain CRYAA CRYA1 HSPB4 Heat shock protein beta-4 protein protein human Homo sapiens Human MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS DIP protein P02489 original sequence version: 121 DIP protein P02489 original sequence version: 131 81804A8439837D50 cryaa_bovin Alpha-crystallin A chain CRYAA CRYA1 protein protein bovin Bos taurus (Bovine) Bovine MDIAIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKIPSGVDAGHSERAIPVSREEKPSSAPSS DIP protein P02470 original sequence version: 86 cryab_bovin Alpha-crystallin B chain CRYAB CRYA2 Alpha(B)-crystallin protein protein bovin Bos taurus (Bovine) Bovine MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPASTSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLAITSSLSSDGVLTVNGPRKQASGPERTIPITREEKPAVTAAPKK DIP protein P02510 original sequence version: 91 May contribute to the transparency and refractive index of the lens mint E0CFBBA8D6DE82B2 cryaa-cryab-11 2 20 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 19 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine direct interaction direct interaction cryaa-1 8 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryaa-cryab-12 3 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryab-4 9 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryab-5 11 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryaa-cryab-13 16 20 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 19 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine direct interaction direct interaction cryaa-2 6 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryaa-cryab-14 13 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryaa-cryab-15 1 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryab-6 7 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryaa-cryab-16 4 20 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 19 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine direct interaction direct interaction cryaa-3 5 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryaa-cryab-17 12 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryab-7 15 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cryaa-cryab-18 10 20 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 19 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine direct interaction direct interaction cryaa-4 14 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction