DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254310X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254315X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254311X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254306X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254314X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254309X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254312X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254308X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254313X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Nature 2009 imex curation Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254307X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. rifk_mouse Riboflavin kinase Rfk ATP:riboflavin 5'-phosphotransferase Flavokinase KOI-4 protein protein mouse Mus musculus Mouse MRSLPFFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADVSTGIYYGWASVGSGDVHKMVVSIGWNPYYKNVKKSMETHIIHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKQLDLPEHLKLKDDNFFQVSKGKIMNGH DIP protein Q8CFV9 original sequence version: 64 cy24a_human Cytochrome b-245 light chain p22 phagocyte B-cytochrome Neutrophil cytochrome b 22 kDa polypeptide p22-phox Cytochrome b(558) alpha chain Cytochrome b558 subunit alpha Superoxide-generating NADPH oxidase light chain subunit CYBA protein protein human Homo sapiens Human MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRKKGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV DIP protein P13498 original sequence version: 99 428427AD19398240 cy24b_human Cytochrome b-245 heavy chain CYBB NOX2 CGD91-phox Cytochrome b(558) subunit beta Heme-binding membrane glycoprotein gp91phox NADPH oxidase 2 Neutrophil cytochrome b 91 kDa polypeptide Superoxide-generating NADPH oxidase heavy chain subunit gp91-1 gp91-phox p22 phagocyte B-cytochrome protein protein human Homo sapiens Human MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF DIP protein P04839 original sequence version: 111 7E84051BD4000CE3 tnr1a_mouse Tumor necrosis factor receptor superfamily member 1A p60 Tumor necrosis factor receptor 1 Tumor necrosis factor receptor type I p55 Tnfrsf1a Tnfr1 Tnfr-1 protein protein mouse Mus musculus Mouse MGLPTVPGLLLSLVLLALLMGIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTAVLLPLVILLGLCLLSFIFISLMCRYPRWRPEVYSIICRDPVPVKEEKAGKPLTPAPSPAFSPTSGFNPTLGFSTPGFSSPVSSTPISPIFGPSNWHFMPPVSEVVPTQGADPLLYESLCSVPAPTSVQKWEDSAHPQRPDNADLAILYAVVDGVPPARWKEFMRFMGLSEHEIERLEMQNGRCLREAQYSMLEAWRRRTPRHEDTLEVVGLVLSKMNLAGCLENILEALRNPAPSSTTRLPR DIP protein P25118 original sequence version: 102 DIP protein P25118 original sequence version: 93 DIP protein P25118 original sequence version: 158 0710C2E8C3C2B6D9 p63000-1 Ras-related C3 botulinum toxin substrate 1 RAC1 Cell migration-inducing gene 5 protein Ras-like protein TC25 TC25 p21-Rac1 MIG5 Rac1A protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL DIP protein P63000-1 original sequence version: 44 DIP protein P63000 original sequence version: 133 DIP protein P63000-1 original sequence version: 128 DIP protein P63000 original sequence version: 90 DIP protein P63000 original sequence version: 91 DIP protein P63000 original sequence version: 92 DIP protein P63000 original sequence version: 80 DIP protein P63000 original sequence version: 106 DIP protein P63000 original sequence version: 95 DIP protein P63000 original sequence version: 112 DIP protein P63000 original sequence version: 128 DIP protein P63000 original sequence version: 137 DIP protein P63000 original sequence version: 157 DIP protein P63000 original sequence version: 116 DIP protein P63000-1 original sequence version: 124 mint ACEDF83A45E5EA67 tradd_human Tumor necrosis factor receptor type 1-associated DEATH domain protein TRADD TNFRSF1A-associated via death domain protein protein human Homo sapiens Human MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA DIP protein Q15628 original sequence version: 92 DIP protein Q15628 original sequence version: 132 DIP protein Q15628 original sequence version: 156 DIP protein Q15628 original sequence version: 77 5645D7E63E5FF05A cy24a_mouse Cytochrome b-245 light chain Cyba Cytochrome b(558) alpha chain Cytochrome b558 subunit alpha Neutrophil cytochrome b 22 kDa polypeptide Superoxide-generating NADPH oxidase light chain subunit p22 phagocyte B-cytochrome p22-phox protein protein mouse Mus musculus Mouse MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRKKGSTMERCGQKYLTSVVKLFGPLTRNYYVRAALHFLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASAGGPQVNPMPVTDEVV DIP protein Q61462 original sequence version: 74 DIP protein Q61462 original sequence version: 113 tradd_mouse Tumor necrosis factor receptor type 1-associated DEATH domain protein Tradd TNFRSF1A-associated via death domain protein protein mouse Mus musculus Mouse MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA DIP protein Q3U0V2 original sequence version: 33 DIP protein Q3U0V2 original sequence version: 26 DIP protein Q3U0V2 original sequence version: 90 225F00D4022691BB rifk_human Riboflavin kinase ATP:riboflavin 5'-phosphotransferase Flavokinase RFK protein protein human Homo sapiens Human MRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEHLKIKEDNFFQVSKSKIMNGH DIP protein Q969G6 original sequence version: 77 3E038E487E164EBA nox1_human NADPH oxidase 1 NOX1 MOX1 NOH1 Mitogenic oxidase 1 NADH/NADPH mitogenic oxidase subunit P65-MOX NOH-1 protein protein human Homo sapiens Human MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF DIP protein Q9Y5S8 original sequence version: 80 tnr1a_human Tumor necrosis factor receptor superfamily member 1A TNFRSF1A TNFAR TNFR1 p60 Tumor necrosis factor receptor 1 Tumor necrosis factor receptor type I p55 protein protein human Homo sapiens Human MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR DIP protein P19438 original sequence version: 135 DIP protein P19438 original sequence version: 150 DIP protein P19438 original sequence version: 177 4CEFBA96D03B8225 p19438-1 Tumor necrosis factor receptor superfamily member 1A Tumor necrosis factor receptor 1 Tumor necrosis factor receptor type I p55 p60 FL-TNFR1 TNFRSF1A TNFAR TNFR1 protein protein human Homo sapiens Human MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR DIP protein P19438-1 original sequence version: 135 DIP protein P19438-1 original sequence version: 164 tnfrsf1a-cyba-1 2 15 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human association association tnfrsf1a-rfk-1 4 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role bait bait Region 331-363 Region 331-363 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tnfrsf1a-rfk-2 3 14 unspecified role unspecified role bait bait mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse 11 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association cyba-1 9 12 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human association association tnfrsf1a-rfk-3 10 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role bait bait Region 331-363 Region 331-363 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tnfrsf1a-rfk-4 6 19 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association rfk-cyba-1 5 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse 11 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association tnfrsf1a-rfk-5 7 16 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human association association rfk-cyba-2 8 12 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human association association rfk-tradd-1 1 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse 11 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association