DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Scheller N., Mina LB., Galão RP., Chari A., Giménez-Barcons M., Noueiry A., Fischer U., Meyerhans A., Díez J. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Scheller N., Mina LB., Galão RP., Chari A., Giménez-Barcons M., Noueiry A., Fischer U., Meyerhans A., Díez J. DIP original experiment: DIP-215977X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Scheller N., Mina LB., Galão RP., Chari A., Giménez-Barcons M., Noueiry A., Fischer U., Meyerhans A., Díez J. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Scheller N., Mina LB., Galão RP., Chari A., Giménez-Barcons M., Noueiry A., Fischer U., Meyerhans A., Díez J. DIP original experiment: DIP-215975X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Scheller N., Mina LB., Galão RP., Chari A., Giménez-Barcons M., Noueiry A., Fischer U., Meyerhans A., Díez J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Scheller N., Mina LB., Galão RP., Chari A., Giménez-Barcons M., Noueiry A., Fischer U., Meyerhans A., Díez J. DIP original experiment: DIP-215976X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Scheller N., Mina LB., Galão RP., Chari A., Giménez-Barcons M., Noueiry A., Fischer U., Meyerhans A., Díez J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Scheller N., Mina LB., Galão RP., Chari A., Giménez-Barcons M., Noueiry A., Fischer U., Meyerhans A., Díez J. DIP original experiment: DIP-215974X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Translation and replication of hepatitis C virus genomic RNA depends on ancient cellular proteins that control mRNA fates. lsm8_human U6 snRNA-associated Sm-like protein LSm8 LSM8 protein protein human Homo sapiens Human MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH DIP protein O95777 original sequence version: 99 15D26E6B75AA2EE1 lsm4_human U6 snRNA-associated Sm-like protein LSm4 Glycine-rich protein LSM4 protein protein human Homo sapiens Human MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ DIP protein Q9Y4Z0 original sequence version: 91 BCEFB20247335A1B lsm7_human U6 snRNA-associated Sm-like protein LSm7 LSM7 protein protein human Homo sapiens Human MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA DIP protein Q9UK45 original sequence version: 87 7429DC0FB365C9C8 lsm1_human U6 snRNA-associated Sm-like protein LSm1 LSM1 CASM Cancer-associated Sm-like Small nuclear ribonuclear CaSm protein protein human Homo sapiens Human MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY DIP protein O15116 original sequence version: 86 FF798CDA9447037A lsm2_human U6 snRNA-associated Sm-like protein LSm2 LSM2 C6orf28 G7B snRNP core Sm-like protein Sm-x5 Small nuclear ribonuclear protein D homolog Protein G7b protein protein human Homo sapiens Human MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ DIP protein Q9Y333 original sequence version: 104 623591A09A6ABACE lsm5_human U6 snRNA-associated Sm-like protein LSm5 LSM5 protein protein human Homo sapiens Human MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV DIP protein Q9Y4Y9 original sequence version: 91 82B5C8830E64C992 lsm6_human U6 snRNA-associated Sm-like protein LSm6 LSM6 protein protein human Homo sapiens Human MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM DIP protein P62312 original sequence version: 63 21167891FDE804F1 lsm3_human U6 snRNA-associated Sm-like protein LSm3 MDS017 LSM3 protein protein human Homo sapiens Human MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG DIP protein P62310 original sequence version: 68 206B0DF0D95CD4D2 lsm1-lsm2-4 2 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association lsm1-lsm2-5 4 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association lsm2-lsm3-19 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association lsm2-lsm3-20 3 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association