DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260384X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260374X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260382X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260377X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260379X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260373X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260372X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260375X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260378X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260381X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260383X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260380X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260376X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. cul3_human Cullin-3 CUL3 KIAA0617 protein protein human Homo sapiens Human MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA DIP protein Q13618 original sequence version: 140 DIP protein Q13618 original sequence version: 163 DIP protein Q13618 original sequence version: 121 DIP protein Q13618 original sequence version: 161 A1A02022480BF099 q13618-1 Cullin-3 CUL3 KIAA0617 Cul-3 Long protein protein human Homo sapiens Human MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA DIP protein Q13618-1 original sequence version: 140 cul5_human Cullin-5 CUL5 VACM1 Vasopressin-activated calcium-mobilizing receptor 1 protein protein human Homo sapiens Human MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA DIP protein Q93034 original sequence version: 160 DIP protein Q93034 original sequence version: 128 DIP protein Q93034 original sequence version: 126 DIP protein Q93034 original sequence version: 142 DIP protein Q93034 original sequence version: 96 57463CB4ED76E303 dcnl3_human DCN1-like protein 3 DCUN1D3 SCCRO3 DCUN1 domain-containing protein 3 Defective in cullin neddylation protein 1-like protein 3 Squamous cell carcinoma-related oncogene 3 protein protein human Homo sapiens Human MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPTSSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKREGEGRGALSSGPEGLCPEEQT DIP protein Q8IWE4 original sequence version: 79 ubc12_human NEDD8-conjugating enzyme Ubc12 UBE2M UBC12 Ubiquitin-conjugating enzyme E2 M NEDD8 carrier protein protein protein human Homo sapiens Human MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK DIP protein P61081 original sequence version: 108 DIP protein P61081 original sequence version: 84 DIP protein P61081 original sequence version: 106 E3C288CA6A98BC5C dcnl2_human DCN1-like protein 2 C13orf17 DCUN1 domain-containing protein 2 DCUN1L2 Defective in cullin neddylation protein 1-like protein 2 DCUN1D2 protein protein human Homo sapiens Human MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF DIP protein Q6PH85 original sequence version: 90 B12A33F80D419A28 cul2_human Cullin-2 CUL2 protein protein human Homo sapiens Human MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA DIP protein Q13617 original sequence version: 129 DIP protein Q13617 original sequence version: 127 DIP protein Q13617-1 original sequence version: 139 DIP protein Q13617 original sequence version: 111 DIP protein Q13617 original sequence version: 102 30647248F671AB0E dcnl1_human DCN1-like protein 1 DCUN1D1 DCUN1L1 RP42 SCCRO Defective in cullin neddylation protein 1-like protein 1 DCUN1 domain-containing protein 1 Squamous cell carcinoma-related oncogene DCN1 protein protein human Homo sapiens Human MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV DIP protein Q96GG9 original sequence version: 94 F3709235E0610C54 cul4a_human Cullin-4A CUL4A protein protein human Homo sapiens Human MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA DIP protein Q13619 original sequence version: 136 DIP protein Q13619 original sequence version: 131 DIP protein Q13619 original sequence version: 129 DIP protein Q13619 original sequence version: 87 DIP protein Q13619 original sequence version: 104 DIP protein Q13619 original sequence version: 151 DIP protein Q13619 original sequence version: 111 DIP protein Q13619 original sequence version: 140 3C4C6A1BBD94D51B cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA DIP protein Q13616 original sequence version: 144 DIP protein Q13616 original sequence version: 133 DIP protein Q13616 original sequence version: null DIP protein Q13616 original sequence version: 135 DIP protein Q13616 original sequence version: 98 DIP protein Q13616 original sequence version: 110 DIP protein Q13616 original sequence version: 146 DIP protein Q13616 original sequence version: 148 DIP protein Q13616 original sequence version: 100 DIP protein Q13616 original sequence version: 85 DIP protein Q13616 original sequence version: 114 DIP protein Q13616 original sequence version: 119 DIP protein Q13616 original sequence version: 136 DIP protein Q13616 original sequence version: 117 DIP protein Q13616 original sequence version: 99 DIP protein Q13616 original sequence version: 108 6625A1FFA7799BBA cul4b_human Cullin-4B CUL4B KIAA0695 protein protein human Homo sapiens Human MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLNSSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLRFEDTLEFVGFDAKMAEESSSSSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSSTTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA DIP protein Q13620 original sequence version: 135 DIP protein Q13620 original sequence version: 98 DIP protein Q13620 original sequence version: 110 DIP protein Q13620 original sequence version: 145 DIP protein Q13620 original sequence version: 119 3E58C5868FDF0700 rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH DIP protein P62877 original sequence version: 120 DIP protein P62877 original sequence version: 115 DIP protein P62877 original sequence version: 78 DIP protein P62877 original sequence version: 113 DIP protein P62877 original sequence version: 75 DIP protein P62877 original sequence version: 86 DIP protein P62877 original sequence version: 136 DIP protein P62877 original sequence version: 126 DIP protein P62877 original sequence version: 90 DIP protein P62877 original sequence version: 114 30FC5ADF66096C0E dcun1d1-cul1-1 7 16 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association dcun1d3-cul1-1 2 14 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait human Homo sapiens Human association association dcun1d3-cul3-1 9 14 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8IWE4:p.[Asp241Ala;Ala265Arg;Asp271Ala] D241A/A265R/D271A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain A R certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D241A/A265R/D271A'. Wed May 02 16:29:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp241ala,ala265arg,asp271ala' Tue Jun 30 19:18:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp241Ala;Ala265Arg;Asp271Ala]' human Homo sapiens Human physical association physical association dcun1d1-cul1-2 10 24 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association cul3-dcun1d3-1 5 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association dcun1d1-ube2m-1 3 18 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association dcun1d3-cul3-2 8 15 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13618-1:p.Arg756Ala R756A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R756A'. Wed May 02 20:00:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg756ala' Tue Jun 30 18:00:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg756Ala' human Homo sapiens Human 17 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association cul3-dcun1d1-1 12 21 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association dcun1d2-ube2m-1 11 19 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 18 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association dcun1d2-cul1-1 6 16 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association ube2m-dcun1d3-1 13 17 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 18 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cul3-cul3-1 1 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cul3-rbx1-1 4 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association