DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Nature structural & molecular biology 2009 imex curation Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. DIP original experiment: DIP-133108X Nature structural & molecular biology 2009 IMEx Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Nature structural & molecular biology 2009 imex curation Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. DIP original experiment: DIP-133103X Nature structural & molecular biology 2009 IMEx Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Nature structural & molecular biology 2009 imex curation Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. DIP original experiment: DIP-133107X Nature structural & molecular biology 2009 IMEx Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Nature structural & molecular biology 2009 imex curation Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. DIP original experiment: DIP-133106X Nature structural & molecular biology 2009 IMEx Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Nature structural & molecular biology 2009 imex curation Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. DIP original experiment: DIP-133102X Nature structural & molecular biology 2009 IMEx Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Nature structural & molecular biology 2009 imex curation Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. DIP original experiment: DIP-133105X Nature structural & molecular biology 2009 IMEx Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. Nature structural & molecular biology 2009 imex curation Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yun SM., Moulaei T., Lim D., Bang JK., Park JE., Shenoy SR., Liu F., Kang YH., Liao C., Soung NK., Lee S., Yoon DY., Lim Y., Lee DH., Otaka A., Appella E., McMahon JB., Nicklaus MC., Burke TR., Yaffe MB., Wlodawer A., Lee KS. DIP original experiment: DIP-133104X Nature structural & molecular biology 2009 IMEx Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1. plk1_human Serine/threonine-protein kinase PLK1 Polo-like kinase 1 Serine/threonine-protein kinase 13 PLK1 PLK protein protein human Homo sapiens Human MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS DIP protein P53350 original sequence version: 169 DIP protein P53350 original sequence version: 170 DIP protein P53350 original sequence version: 164 DIP protein P53350 original sequence version: 154 DIP protein P53350 original sequence version: 91 DIP protein P53350 original sequence version: 145 DIP protein P53350 original sequence version: 121 DIP protein P53350 original sequence version: 118 DIP protein P53350 original sequence version: 123 DIP protein P53350 original sequence version: 119 DIP protein P53350 original sequence version: 138 DIP protein P53350 original sequence version: 163 DIP protein P53350 original sequence version: 178 178C2F13C10E8206 q71f23-1 Centromere protein U Centromere protein of 50 kDa Interphase centromere complex protein 24 KSHV latent nuclear antigen-interacting protein 1 MLF1-interacting protein Polo-box-interacting protein 1 CENPU ICEN24 KLIP1 MLF1IP PBIP1 protein protein human Homo sapiens Human MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGENEKDEETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESVTSKKTGPLSAQPSVEKENLAIESQSKTQKKGKISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG DIP protein Q71F23-1 original sequence version: 49 mpip3_human M-phase inducer phosphatase 3 CDC25C Dual specificity phosphatase Cdc25C protein protein human Homo sapiens Human MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP DIP protein P30307 original sequence version: 148 DIP protein P30307 original sequence version: 88 DIP protein P30307 original sequence version: 112 DIP protein P30307 original sequence version: 108 0658A1F1B9B8996A cenpu-plk1-1 1 9 unspecified role unspecified role unspecified role unspecified role Region 74-78 Region 74-78 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Region 75-79 Region 75-79 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cenpu-plk1-2 4 9 unspecified role unspecified role bait bait Region 74-78 Region 74-78 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 75-79 Region 75-79 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association plk1-cdc25c-3 5 10 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association plk1-cdc25c-4 2 10 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait Polo box domain Region 326-603 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association cenpu-plk1-3 3 9 unspecified role unspecified role unspecified role unspecified role Region 74-78 Region 74-78 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 75-79 Region 75-79 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cenpu-plk1-4 6 9 unspecified role unspecified role bait bait Region 74-78 Region 74-78 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 75-79 Region 75-79 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cenpu-plk1-5 7 9 unspecified role unspecified role bait bait Region 74-78 Region 74-78 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain pT78 pT78 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role prey prey Polo box domain Region 326-603 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P53350:p.[His538Ala;Lys540Met] H538A/K540M mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K M certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H538A/K540M'. Wed May 02 18:17:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his538ala,lys540met' Tue Jun 30 19:58:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His538Ala;Lys540Met]' ecolx Escherichia coli direct interaction direct interaction