DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu GPR17 is a negative regulator of the cysteinyl leukotriene 1 receptor response to leukotriene D4. GPR17 is a negative regulator of the cysteinyl leukotriene 1 receptor response to leukotriene D4. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Maekawa A., Balestrieri B., Austen KF., Kanaoka Y. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Maekawa A., Balestrieri B., Austen KF., Kanaoka Y. DIP original experiment: DIP-134355X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx GPR17 is a negative regulator of the cysteinyl leukotriene 1 receptor response to leukotriene D4. GPR17 is a negative regulator of the cysteinyl leukotriene 1 receptor response to leukotriene D4. GPR17 is a negative regulator of the cysteinyl leukotriene 1 receptor response to leukotriene D4. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Maekawa A., Balestrieri B., Austen KF., Kanaoka Y. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Maekawa A., Balestrieri B., Austen KF., Kanaoka Y. DIP original experiment: DIP-134356X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx GPR17 is a negative regulator of the cysteinyl leukotriene 1 receptor response to leukotriene D4. cltr1_mouse Cysteinyl leukotriene receptor 1 Cysltr1 Cyslt1 Cyslt1r Cysteinyl leukotriene D4 receptor protein protein mouse Mus musculus Mouse MYLQGTKQTFLENMNGTENLTTSLINNTCHDTIDEFRNQVYSTMYSVISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWLFGDFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSPFLMYKSYQDEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIVCYTMIILTLLKNTMKKNMPSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKASLPEKGEEICNE DIP protein Q99JA4 original sequence version: 79 gpr17_mouse Uracil nucleotide/cysteinyl leukotriene receptor Gpr17 G-protein coupled receptor 17 protein protein mouse Mus musculus Mouse MNGLEAALPSLTDNSSLAYSEQCGQETPLENMLFACFYLLDFILAFVGNALALWLFIWDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIPCRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWIVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALASLAVAFTFPFITTVTCYLLIIRSLRQGPRIEKHLKNKAVRMIAMVLAIFLICFVPYHIHRSVYVLHYRGGGTSCAAQRALALGNRITSCLTSLNGALDPVMYFFVAEKFRHALCNLLCSKRLTGPPPSFEGKTNESSLSARSEL DIP protein Q6NS65 original sequence version: 57 gpr17-cysltr1-1 1 3 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 4 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association cysltr1-gpr17-1 2 3 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 4 unspecified role unspecified role prey prey YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association