DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Mo-Se active site of nicotinate dehydrogenase. The Mo-Se active site of nicotinate dehydrogenase. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Wagener N., Pierik AJ., Ibdah A., Hille R., Dobbek H. Only protein-protein interactions clostridium barkeri Eubacterium barkeri Clostridium barkeri x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wagener N., Pierik AJ., Ibdah A., Hille R., Dobbek H. DIP original experiment: DIP-134348X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Mo-Se active site of nicotinate dehydrogenase. The Mo-Se active site of nicotinate dehydrogenase. The Mo-Se active site of nicotinate dehydrogenase. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Wagener N., Pierik AJ., Ibdah A., Hille R., Dobbek H. Only protein-protein interactions clostridium barkeri Eubacterium barkeri Clostridium barkeri molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wagener N., Pierik AJ., Ibdah A., Hille R., Dobbek H. DIP original experiment: DIP-134349X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Mo-Se active site of nicotinate dehydrogenase. ndsfs_eubba Nicotinate dehydrogenase small FeS subunit ndhS Nicotinic acid hydroxylase small FeS subunit protein protein clostridium barkeri Eubacterium barkeri Clostridium barkeri MNKITINLNLNGEARSIVTEPNKRLLDLLREDFGLTSVKEGCSEGECGACTVIFNGDPVTTCCMLAGQADESTIITLEGVAEDGKPSLLQQCFLEAGAVQCGYCTPGMILTAKALLDKNPDPTDEEITVAMSGNLCRCTGYIKIHAAVRYAVERCAN DIP protein Q0QLF3 original sequence version: 30 4750940AB90ED093 ndfs_eubba Nicotinate dehydrogenase FAD-subunit ndhF Nicotinic acid hydroxylase FAD-subunit protein protein clostridium barkeri Eubacterium barkeri Clostridium barkeri MKDFEFFAPKTLEEAKGLLHQYKDVPPAIIAGGTDLVIEINDRWEKPDVVIDIKKLKELEYIRVEENTIHIGALSTFTQIENHPFIRSHVRALYKAASQVGSPQIRNLGTIGGNLSTSSVAGDGVSAMTTLDATVVLESVRGTRQMKLTDFFDGEGFKRRNALEADEIMTEVIIDRPDAHSASAFYKLAKRKSLAISVIGGGMAVKVDDAGVCTWASMRGGCIGRYPLHFKQAEEMLVGAPLTMETMEATLPILHDTVYDMARARPSVLYKKESVQGVFKKLFVDILDQLEGGCNE DIP protein Q0QLF4 original sequence version: 24 B14B447981D8E7FD ndlms_eubba Nicotinate dehydrogenase large molybdopterin subunit ndhL Nicotinic acid hydroxylase large molybdopterin subunit protein protein clostridium barkeri Eubacterium barkeri Clostridium barkeri MGKDYQVLGKNKVKVDSLEKVMGTAKFAADYSFPDMLYAGVFRSTVPHARIVSLDLSKARAIDGVEAVLDYHAIPGKNRFGIIIKDEPCLVDDKVRRYGDAIAVVAAQTPDLVQEALDAITIEYEELEGIFTMERALEEDSPAIHGDTNIHQVKHLEYGDVDAAFKQCDIVVEDTYSTHRLTHMFIEPDAGVSYYDNEGMLTVVVSTQNPHYDRGEVAGMLALPNSKVRIIQATTGGGFGGKLDLSVQCHCALLTYHTKKPVKMVRSREESTTVSSKRHPMTMHCKTGATKDGRLQAVQVEMFGDTGAYASYGPAVITRATVHCMGPYVVPNVRVDAKFVYTNNPMSGAFRGFGVPQASVCHEGQMNALAKALGMDPIDIRILNAHQVGAKLATGQVLENSVGLIETLEKAREKAVEVMGYEKTR DIP protein Q0QLF2 original sequence version: 22 F8270B4ABECD71A5 ndmms_eubba Nicotinate dehydrogenase medium molybdopterin subunit ndhM Nicotinic acid hydroxylase medium molybdopterin subunit protein protein clostridium barkeri Eubacterium barkeri Clostridium barkeri MKKRGKGVGSMWYGIGNTGLPNPAAAFVEIHGDGSANVMFGAADIGQGSGTAMAQIAAEELGLDYEKIHVTWGDTMVTPDGGATSASRQTLITGNAVILACRQAKETLAKTAAEKLDCAPEELSFRDNTVFITADPERSMTYGELMAAMKAAGRMAVGAGSYNPNTTGLAPENMSGIPFEVYSYATTIAEVEVDTETGEVDVLKVVSAHDVGTPINRSMVEGQIEGGVTMGQGFVLMEEIEVNTKNGAIKNPSMSKYIIPSNRDVPEIHSILVESEGGPGPFGAKGVGEPALIPMIPAVVAAIEDALGTRFTHTPIMPKDIVAAVKAQEK DIP protein Q0QLF1 original sequence version: 22 1190FDAC03FB5C08 ndhf-ndhl-1 1 6 unspecified role unspecified role unspecified role unspecified role clostridium barkeri Eubacterium barkeri Clostridium barkeri 5 unspecified role unspecified role unspecified role unspecified role clostridium barkeri Eubacterium barkeri Clostridium barkeri 3 unspecified role unspecified role unspecified role unspecified role clostridium barkeri Eubacterium barkeri Clostridium barkeri 4 unspecified role unspecified role unspecified role unspecified role clostridium barkeri Eubacterium barkeri Clostridium barkeri physical association physical association ndhf-ndhl-2 2 6 unspecified role unspecified role unspecified role unspecified role clostridium barkeri Eubacterium barkeri Clostridium barkeri 5 unspecified role unspecified role unspecified role unspecified role clostridium barkeri Eubacterium barkeri Clostridium barkeri 3 unspecified role unspecified role unspecified role unspecified role clostridium barkeri Eubacterium barkeri Clostridium barkeri 4 unspecified role unspecified role unspecified role unspecified role clostridium barkeri Eubacterium barkeri Clostridium barkeri physical association physical association