DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Identification of a consensus motif in substrates bound by a Type I Hsp40. Identification of a consensus motif in substrates bound by a Type I Hsp40. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kota P., Summers DW., Ren HY., Cyr DM., Dokholyan NV. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kota P., Summers DW., Ren HY., Cyr DM., Dokholyan NV. DIP original experiment: DIP-216076X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of a consensus motif in substrates bound by a Type I Hsp40. Identification of a consensus motif in substrates bound by a Type I Hsp40. Identification of a consensus motif in substrates bound by a Type I Hsp40. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kota P., Summers DW., Ren HY., Cyr DM., Dokholyan NV. Only protein-protein interactions in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Kota P., Summers DW., Ren HY., Cyr DM., Dokholyan NV. DIP original experiment: DIP-216075X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of a consensus motif in substrates bound by a Type I Hsp40. mas5_yeast Mitochondrial protein import protein MAS5 YDJ1 MAS5 YNL064C N2418 YNL2418C Yeast dnaJ protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCASQ E4539F3618DD9CF2 E4539F3618DD9CF2 rnq1_yeast [PIN+] prion protein RNQ1 RNQ1 YCL028W YCL28W YCL181 Rich in asparagine and glutamine protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIAGYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATVMTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGNNSQGQGQGQGQGQGQGQGQGQGSFTALASLASSFMNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSYQNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQSNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASSYLGNNSNSNSSYGGQQQANEYGRPQQNGQQQSNEYGRPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY 8ED9C40A7DF70F7F 8ED9C40A7DF70F7F p1 Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YNKDQFDGWLYEISRKQAQQN p1-ydj1-1 2 3 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal in vitro In vitro direct interaction direct interaction rnq1-ydj1-1 1 4 unspecified role unspecified role bait bait Prion domain Region 245-269 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P25367:p.Asn253Tyr N253Y mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N Y This feature has been corrected as a result of our quality control procedures. The original label was 'N253Y'. Wed May 02 16:37:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn253tyr' Tue Jun 30 18:33:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn253Tyr' P25367:p.Gln257Tyr Q257Y mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q Y This feature has been corrected as a result of our quality control procedures. The original label was 'Q257Y'. Wed May 02 15:43:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln257tyr' Tue Jun 30 18:50:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln257Tyr' ecolx Escherichia coli 3 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction