IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The B7 family member B7-H6 is a tumor cell ligand for the activating natural killer cell receptor NKp30 in humans. The B7 family member B7-H6 is a tumor cell ligand for the activating natural killer cell receptor NKp30 in humans. The Journal of experimental medicine 2009 imex curation Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD., Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD. NKp30 has been assumed to be of Human origin as no Mouse protein can be found in UniProt or NCBI databases;NCR3 is a nonexpressed pseudogene in most mouse strains. levins@zgi.com,vivier@ciml.univ-mrs.fr 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD., Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD. It is not stated if Biotinylated NKp30-Fc has a mouse or human Fc tag, nor is it stated if NKp30-Fc was expressed from 293 or CHO cells. DSP=93 ?species of mols There is a RAT NKp30 protein in existence, but no mention of "Rat" or any other species in this publication. bis(sulfosuccinimidyl) suberate as cross-linker. NKp30 has been assumed to be of Human origin as no Mouse protein can be found in UniProt or NCBI databases;NCR3 is a nonexpressed pseudogene in most mouse strains. levins@zgi.com,vivier@ciml.univ-mrs.fr Accepted 2017-JUN-05 AT 09:53 BST AT 09:53 BST by ORCHARD The Journal of experimental medicine 2009 imex curation The B7 family member B7-H6 is a tumor cell ligand for the activating natural killer cell receptor NKp30 in humans. The B7 family member B7-H6 is a tumor cell ligand for the activating natural killer cell receptor NKp30 in humans. The Journal of experimental medicine 2009 imex curation Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD., Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD. NKp30 has been assumed to be of Human origin as no Mouse protein can be found in UniProt or NCBI databases;NCR3 is a nonexpressed pseudogene in most mouse strains. levins@zgi.com,vivier@ciml.univ-mrs.fr 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD., Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD. DSP=93 ?species of mols There is a RAT NKp30 protein in existence, but no mention of "Rat" or any other species in this publication. NKp30 has been assumed to be of Human origin as no Mouse protein can be found in UniProt or NCBI databases;NCR3 is a nonexpressed pseudogene in most mouse strains. levins@zgi.com,vivier@ciml.univ-mrs.fr Accepted 2017-JUN-05 AT 09:53 BST AT 09:53 BST by ORCHARD The Journal of experimental medicine 2009 imex curation nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG DIP protein O14931 original sequence version: 110 2855AE4D6902D429 nr3l1_human Natural cytotoxicity triggering receptor 3 ligand 1 NCR3LG1 B7 homolog 6 B7H6 protein protein human Homo sapiens Human MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIVLIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQLDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDAPILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ DIP protein Q68D85 original sequence version: 74 433CE0B0EE0A4470 ncr3-ncr3lg1-3 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Text above Fig 2 ncr3-ncr3lg1-4 2 4 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 3 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 14 direct interaction direct interaction Fig 2 A/D