DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132654X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132648X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132658X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132656X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132657X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132651X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132649X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132647X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132655X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132650X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132653X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. PLoS biology 2009 imex curation Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadri Z., Shimizu R., Ohneda O., Maouche-Chretien L., Gisselbrecht S., Yamamoto M., Romeo PH., Leboulch P., Chretien S. DIP original experiment: DIP-132652X PLoS biology 2009 IMEx Direct binding of pRb/E2F-2 to GATA-1 regulates maturation and terminal cell division during erythropoiesis. gata1_mouse Erythroid transcription factor Gata1 Gf-1 Eryf1 GATA-binding factor 1 NF-E1 DNA-binding protein protein protein mouse Mus musculus Mouse MDFPGLGALGTSEPLPQFVDSALVSSPSDSTGFFSSGPEGLDAASSSTSPNAATAAASALAYYREAEAYRHSPVFQVYPLLNSMEGIPGGSPYASWAYGKTALYPASTVCPSHEDAPSQALEDQEGKSNNTFLDTLKTERLSPDLLTLGTALPASLPVTGSAYGGADFPSPFFSPTGSPLSSAAYSSPKFHGSLPLAPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSNLAGAGAAEGPAGGFMVVAGSSSSGNCGEVASGLALGTAGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTTSFPTGPAPTTSSTSVIAPLSS DIP protein P17679 original sequence version: 100 gata1_human Erythroid transcription factor GATA1 ERYF1 GF1 Eryf1 GATA-binding factor 1 NF-E1 DNA-binding protein protein protein human Homo sapiens Human MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS DIP protein P15976 original sequence version: 163 DIP protein P15976 original sequence version: 113 DIP protein P15976 original sequence version: 146 822BD2DE14B908AD fog1_mouse Zinc finger protein ZFPM1 Zfpm1 Fog Fog1 Friend of GATA protein 1 Zinc finger protein multitype 1 protein protein mouse Mus musculus Mouse MSRRKQSNPRQIKRSLRDMEAGEEAKAMDSSPKEQEAPDPEAPAIEEPPSPPREDVSPPAVPAPPESPEDPEDMEGQELEMRPQDEEKEEKEEEAAMASPWSGPEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPEREEPGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGLLYVRLVTEPHGAPRHPVQEPVEPGGLAPVHTDIQLLPQQAGMASILATAVINKDVFPCKDCGIWYRSERNLQAHLLYYCASRQRAGSPVSATEEKPKETYPNERVCPFPQCRKSCPSASSLEIHMRSHSGERPFVCLICLSAFTTKANCERHLKVHTDTLSGVCHNCGFISTTRDILYSHLVTNHMVCQPGSKGEIYSPGAGHPAAKLPPDSLAGFQQHSLMHSPLVPADKAPTPSSGLDSKAEVTNGETRVPPQNGGSSESPAAPRTIKVEAAEEPEATRASGPGEPGPQAPSRTPSPHSPNPVRVKTELSSPTPGSSPGPGELTMAGTLFLPQYVFSPDAGTTTVPTAPQASEILAKMSELVHNRLQQGAGSSGAAGTPTGLFSGTKGATCFECEITFNNINNFYVHKRLYCSGRRAPEDPPTVRRPKAATGPARAPAGAAAEPDPSRSSPGPGPREEEASGTTTPEAEAAGRGSEGSQSPGSSVDDAEDDPSRTLCEACNIRFSRHETYTVHKRYYCASRHDPPPRRPPAPTTAPGPAAPALTAPPVRTRRRRKLYELPAAGAPPPAAGPAPVPVVPSPTAELPSSPRPGSASAGPAPALSPSPVPDGPIDLSKRPRRQSPDAPTALPALADYHECTACRVSFHSLEAYLAHKKYSCPAAPLRTTALCPYCPPNGRVRGDLVEHLRQAHGLQVAKPAASPGAEPRTPAERAPRDSPDGRAPRSPSPAPENTPSDPADQGARTPSKGPPAPAPAPGGGGGHRYCRLCNIRFSSLSTFIAHKKYYCSSHAAEHVK DIP protein O35615 original sequence version: 82 293255B28151ECB8 e2f2_mouse Transcription factor E2F2 E2f2 protein protein mouse Mus musculus Mouse MLRAPRTLAPATAQPTKSLPALNPTELWPSGLSSPQLCPATTATTYYTSLYTQTVPSSVALGTCLDATPHGPEGQIVRCAPAGRLPAKRKLDLEGIGRPTVPEFRTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKSKNNIQWVGRELFEDPTRPSRQQQLGQELKELMNAEQTLDQLIQSCSLSFKHLTEDNANKKLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRAEENLQIYLKSTQGPIEVYLCPEEGQEPDSPAKEALPSTSALSPIPDCAQPGCSTDSGIAETIEPSVLIPQPIPPPPPPPLPPAPSLVPLEATDNMLELSHPLLQQTEDQFLSPILAANSPLISFSPPLDQDEYLWGMDEGEGISDLFDSYDLGDLLIN DIP protein P56931 original sequence version: 80 mint Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F-2 binds specifically to RB1 protein, in a cell-cycle dependent manner DFC8158E5A8254F0 rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 rb_mouse Retinoblastoma-associated protein Rb1 Rb-1 pRb pp105 p110-RB1 protein protein mouse Mus musculus Mouse MPPKAPRRAAAAEPPPPPPPPPREDDPAQDSGPEELPLARLEFEEIEEPEFIALCQKLKVPDHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEMPFTFTELQKSIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSALSTEINSMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVVDYFIKFSPPALLREPYKTAAIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFINSLGIVSSNGLPEVESLSKRYEEVYLKNKDLDARLFLDHDKTLQTDPIDSFETERTPRKNNPDEEANVVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFNNCTVNPKENILKRVKDVGHIFKEKFANAVGQGCVDIGVQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTLQHLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDNLEPACPLSLPLQGNHTAADMYLSPLRSPKKRTSTTRVNSAANTETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGADEADGSKHLPAESKFQQKLAEMTSTRTRMQKQRMNESKDVSNKEEK DIP protein P13405 original sequence version: 115 DIP protein P13405 original sequence version: 114 DIP protein P13405 original sequence version: 110 AE81D35A07ADB493 fog1_human Zinc finger protein ZFPM1 ZFPM1 FOG1 ZFN89A Friend of GATA protein 1 Zinc finger protein 89A Zinc finger protein multitype 1 protein protein human Homo sapiens Human MSRRKQSNPRQIKRSLGDMEAREEVQLVGASHMEQKATAPEAPSPPSADVNSPPPLPPPTSPGGPKELEGQEPEPRPTEEEPGSPWSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHGSVQTRASSPRQAEPSPALTLLLVDEACWLRTLPQALTEAEANTEIHRKDDALWCRVTKPVPAGGLLSVLLTAEPHSTPGHPVKKEPAEPTCPAPAHDLQLLPQQAGMASILATAVINKDVFPCKDCGIWYRSERNLQAHLLYYCASRQGTGSPAAAATDEKPKETYPNERVCPFPQCRKSCPSASSLEIHMRSHSGERPFVCLICLSAFTTKANCERHLKVHTDTLSGVCHSCGFISTTRDILYSHLVTNHMVCQPGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGLAPTPSPGLDRKALAEATNGEARAEPLAQNGGSSEPPAAPRSIKVEAVEEPEAAPILGPGEPGPQAPSRTPSPRSPAPARVKAELSSPTPGSSPVPGELGLAGALFLPQYVFGPDAAPPASEILAKMSELVHSRLQQGAGAGAGGAQTGLFPGAPKGATCFECEITFSNVNNYYVHKRLYCSGRRAPEDAPAARRPKAPPGPARAPPGQPAEPDAPRSSPGPGAREEGAGGAATPEDGAGGRGSEGSQSPGSSVDDAEDDPSRTLCEACNIRFSRHETYTVHKRYYCASRHDPPPRRPAAPPGPPGPAAPPAPSPAAPVRTRRRRKLYELHAAGAPPPPPPGHAPAPESPRPGSGSGSGPGLAPARSPGPAADGPIDLSKKPRRPLPGAPAPALADYHECTACRVSFHSLEAYLAHKKYSCPAAPPPGALGLPAAACPYCPPNGPVRGDLLEHFRLAHGLLLGAPLAGPGVEARTPADRGPSPAPAPAASPQPGSRGPRDGLGPEPQEPPPGPPPSPAAAPEAVPPPPAPPSYSDKGVQTPSKGTPAPLPNGNHRYCRLCNIKFSSLSTFIAHKKYYCSSHAAEHVK DIP protein Q8IX07 original sequence version: 66 E9C2363503A64898 gata1-rb1-1 7 17 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association gata1-rb1-2 8 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse 14 unspecified role unspecified role bait bait P15976:p.[Cys83Gly;Glu85Lys] C83G/E85K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K certain certain sequence position certain certain certain sequence position certain C G This feature has been corrected as a result of our quality control procedures. The original label was 'C83G/E85K'. Wed May 02 17:34:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83gly,glu85lys' Tue Jun 30 16:19:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys83Gly;Glu85Lys]' Region 1-83 Region 1-83 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association gata1-zfpm1-1 12 13 unspecified role unspecified role bait bait mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association rb1-gata1-1 5 18 unspecified role unspecified role bait bait mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association gata1-zfpm1-2 1 19 unspecified role unspecified role prey prey mouse Mus musculus Mouse 14 unspecified role unspecified role bait bait P15976:p.Val205Gly V205G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V G This feature has been corrected as a result of our quality control procedures. The original label was 'V205G'. Wed May 02 18:45:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val205gly' Tue Jun 30 17:13:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val205Gly' mouse Mus musculus Mouse physical association physical association rb1-gata1-2 10 17 unspecified role unspecified role bait bait human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association rb1-gata1-3 2 18 unspecified role unspecified role bait bait mouse Mus musculus Mouse 14 unspecified role unspecified role prey prey P15976:p.[Cys83Gly;Glu85Lys] C83G/E85K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K certain certain sequence position certain certain certain sequence position certain C G This feature has been corrected as a result of our quality control procedures. The original label was 'C83G/E85K'. Wed May 02 19:28:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83gly,glu85lys' Tue Jun 30 19:18:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys83Gly;Glu85Lys]' Region 1-83 Region 1-83 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association e2f2-gata1-1 11 16 unspecified role unspecified role bait bait mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association zfpm1-gata1-1 9 19 unspecified role unspecified role bait bait mouse Mus musculus Mouse 14 unspecified role unspecified role prey prey P15976:p.Val205Gly V205G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V G This feature has been corrected as a result of our quality control procedures. The original label was 'V205G'. Wed May 02 14:59:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val205gly' Tue Jun 30 17:42:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val205Gly' mouse Mus musculus Mouse physical association physical association zfpm1-gata1-2 6 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association gata1-rb1-3 4 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association gata1-e2f2-1 3 16 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association