DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Direct single-molecule observation of a protein living in two opposed native structures. Direct single-molecule observation of a protein living in two opposed native structures. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Gambin Y., Schug A., Lemke EA., Lavinder JJ., Ferreon AC., Magliery TJ., Onuchic JN., Deniz AA. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Gambin Y., Schug A., Lemke EA., Lavinder JJ., Ferreon AC., Magliery TJ., Onuchic JN., Deniz AA. DIP original experiment: DIP-134310X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Direct single-molecule observation of a protein living in two opposed native structures. Direct single-molecule observation of a protein living in two opposed native structures. Direct single-molecule observation of a protein living in two opposed native structures. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Gambin Y., Schug A., Lemke EA., Lavinder JJ., Ferreon AC., Magliery TJ., Onuchic JN., Deniz AA. Only protein-protein interactions in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Gambin Y., Schug A., Lemke EA., Lavinder JJ., Ferreon AC., Magliery TJ., Onuchic JN., Deniz AA. DIP original experiment: DIP-134309X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Direct single-molecule observation of a protein living in two opposed native structures. rop_ecolx Regulatory protein rop rop RNA one modulator protein protein ecolx Escherichia coli MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGDDGENL 0A1986BD29CF6FE4 rop-1 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rop-2 1 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alex647-label Alex647-label alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role fluorescence donor fluorescence donor Alexa488-label Alexa488-label alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction