DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SpaK/SpaR two-component system characterized by a structure-driven domain-fusion method and in vitro phosphorylation studies. SpaK/SpaR two-component system characterized by a structure-driven domain-fusion method and in vitro phosphorylation studies. PLoS computational biology 2009 imex curation Chakicherla A., Ecale Zhou CL., Dang ML., Rodriguez V., Hansen JN., Zemla A. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Chakicherla A., Ecale Zhou CL., Dang ML., Rodriguez V., Hansen JN., Zemla A. DIP original experiment: DIP-132330X PLoS computational biology 2009 IMEx SpaK/SpaR two-component system characterized by a structure-driven domain-fusion method and in vitro phosphorylation studies. SpaK/SpaR two-component system characterized by a structure-driven domain-fusion method and in vitro phosphorylation studies. SpaK/SpaR two-component system characterized by a structure-driven domain-fusion method and in vitro phosphorylation studies. PLoS computational biology 2009 imex curation Chakicherla A., Ecale Zhou CL., Dang ML., Rodriguez V., Hansen JN., Zemla A. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Chakicherla A., Ecale Zhou CL., Dang ML., Rodriguez V., Hansen JN., Zemla A. DIP original experiment: DIP-132329X PLoS computational biology 2009 IMEx SpaK/SpaR two-component system characterized by a structure-driven domain-fusion method and in vitro phosphorylation studies. spar_baciu Transcriptional regulatory protein SpaR spaR Subtilin biosynthesis regulatory protein SpaR protein protein baciu Bacillus subtilis MAKILAVDDEKDILVLIQNILRRDQHQVDILDHVHGQPPDVFQGYDLILLDVMMPDIDGFELCKQIRPLVDCPILFLTAKTEEEAIVKGLITGGDDYITKPFGVRELSARVNAHLRRERRDKHQSKRVISGFLFHFDSKEVFINNNKLNLTKNEYKICEFLAQHKGRTFSREQIYEEIYGLEGNALYSTITEFIRTIRKKCKEHNADPIKTVWGVGYKWE DIP protein P33112 original sequence version: 79 spak_baciu Sensor histidine kinase SpaK spaK Subtilin biosynthesis sensor protein SpaK protein protein baciu Bacillus subtilis MGIGFKGRKTLLRELVKYMVTLCISLVVLALLYIFINTIAMNTGFSHPANYNEREAEKLAPKLETIDKVTADMIPDTMSYAILNKETKQKTAGTIKEKDLQLVKKKIEKKPYVNYKQKGYLVIERNNEYCVLQYSLRADFSSPLLRKYLPNYELTSICILIILLIIVISIITTYFANRLRKHFETLNVITRYIKEQNLQFTPEFTHIKEFDDVIDSLIEMRDALQSSLEALWRLEKNKKEQIGALAHEIKIPITIIKGNAELLSLSMQNEEQAEYTKYILGAGNQIEQYIYQLIHLSKTEDALTIHLEKASVDELTETLVKDISAYKGNKNINISFKKENLMKEAKIDWQLLHRALLNILTNAVDYTPEGGTVSVHAECDSEIFYFFVKDTGNGFSEMGLKKATELFYMDDKSRHSKGHYGMGLTFAKNAVNLHNGELTLGNTIAGGAEVRVKIPLRNE DIP protein P33113 original sequence version: 79 spak-spar-1 2 3 phosphate acceptor phosphate acceptor neutral component neutral component phosphorylation site phosphorylation site phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 4 phosphate donor phosphate donor neutral component neutral component phosphorylation site phosphorylation site phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer spak-spak-1 1 4 unspecified role unspecified role unspecified role unspecified role P33113:p.Gly392Ala G392A mutation mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain G A Wed May 02 19:55:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly392ala' Tue Jun 30 19:15:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly392Ala' ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role P33113:p.His247Gln H247Q mutation mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain H Q Wed May 02 19:48:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his247gln' Tue Jun 30 15:47:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His247Gln' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation