DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260304X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260311X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260307X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260303X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260306X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260302X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260305X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260310X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260308X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. IpaB-IpgC interaction defines binding motif for type III secretion translocator. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260309X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. ipab_shifl Invasin IpaB 62 kDa antigen ipaB CP0128 protein protein shifl Shigella flexneri MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGKILGALLTIVSVVAAAFSGGASLALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEGLGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA DIP protein P18011 original sequence version: 101 56325105E4BC0F70 o87496_yeren sycD protein protein YEREN_W22703 Yersinia enterocolitica W22703 MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHECVDNP DIP protein O87496 original sequence version: 60 yopd_yeren Protein YopD yopD protein protein yeren Yersinia enterocolitica MTINIKTDSPIITTGSQLDAITTETVGQSGEVKKTEDTRHEAQAIKSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQQRDIENKATISAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQEQILNSNIAGRDQLIDTKMQQMSNAGDKAVSREDIGRIWKPEQVADQNKLALLDKEFRMTDSKANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNYNDNFMKDVLRLIEQYVSSHTHAMKAAFGVV DIP protein P37132 original sequence version: 37 00F6B852D95EDAD0 ipgc_shifl Chaperone protein IpgC ipgC ippI CP0129 protein protein shifl Shigella flexneri MSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE DIP protein P0A2U4 original sequence version: 58 F46E39A92B8ADEC7 sica_salty Chaperone protein SicA sicA spaT STM2886 Salmonella invasin chaperone protein protein salty Salmonella typhimurium MDYQNNVSEERVAEMIWDAVSEGATLKDVHGIPQDMMDGLYAHAYEFYNQGRLDEAETFFRFLCIYDFYNPDYTMGLAAVCQLKKQFQKACDLYAVAFTLLKNDYRPVFFTGQCQLLMRKAAKARQCFELVNERTEDESLRAKALVYLEALKTAETEQHSEQEKE DIP protein P69066 original sequence version: 66 yopb_yeren Protein YopB yopB protein protein yeren Yersinia enterocolitica MSALITHDRSTPVTGSLVPYIETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGMASKIFGWLIAIASVVIGAIMVASGVGAVAGAMMIASGVIGMANMAVKQAAEDGLISQEAMQVLGPILTAIEVALTVVSTVMTFGGSALKCLADIGAKLGANTASLAAKGAEFSAKVAQISTGISNTVGSAVTKLGGSFGSLTMSHVIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHRQVMELIFQMINAKGDMLHNLAGRPHTV DIP protein P37131 original sequence version: 56 519B9414432547A6 ipab-ipgc-1 6 11 unspecified role unspecified role unspecified role unspecified role Region 51-72 Region 51-72 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ipgc-1 1 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ipgc-2 3 14 unspecified role unspecified role unspecified role unspecified role P0A2U4:p.[Ala94Glu;Val95Gln] A94E/V95Q mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V Q certain certain sequence position certain certain certain sequence position certain A E This feature has been corrected as a result of our quality control procedures. The original label was 'A94E/V95Q'. Wed May 02 15:07:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala94glu,val95gln' Tue Jun 30 19:03:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala94Glu;Val95Gln]' ecolx Escherichia coli direct interaction direct interaction sycd-yopb-1 8 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 50-55 Region 50-55 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction ipgc-3 7 14 unspecified role unspecified role unspecified role unspecified role P0A2U4:p.[Ala94Glu;Val95Gln] A94E/V95Q mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V Q certain certain sequence position certain certain certain sequence position certain A E This feature has been corrected as a result of our quality control procedures. The original label was 'A94E/V95Q'. Wed May 02 17:45:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala94glu,val95gln' Tue Jun 30 19:46:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala94Glu;Val95Gln]' ecolx Escherichia coli direct interaction direct interaction sica-1 9 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ipab-ipgc-2 4 11 unspecified role unspecified role unspecified role unspecified role Region 65-70 Region 65-70 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P18011:p.Pro70Asp P70D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P D This feature has been corrected as a result of our quality control procedures. The original label was 'P70D'. Wed May 02 16:13:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro70asp' Tue Jun 30 17:16:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro70Asp' P18011:p.Leu67Asn L67N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L N This feature has been corrected as a result of our quality control procedures. The original label was 'L67N'. Wed May 02 20:18:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu67asn' Tue Jun 30 17:33:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu67Asn' P18011:p.Pro65Arg P65R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P R This feature has been corrected as a result of our quality control procedures. The original label was 'P65R'. Wed May 02 17:10:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro65arg' Tue Jun 30 18:04:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro65Arg' P18011:p.Lys68Ala K68A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K68A'. Wed May 02 17:07:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys68ala' Tue Jun 30 19:27:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys68Ala' in vitro In vitro 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ipab-ipgc-3 10 11 unspecified role unspecified role unspecified role unspecified role Region 65-70 Region 65-70 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 14 unspecified role unspecified role unspecified role unspecified role P0A2U4:p.[Ser41Met;Tyr44Gly;Gly75Gln;Ala78Met] S41M/Y44G/G75Q/A78M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A M certain certain sequence position certain certain certain sequence position certain G Q certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain S M This feature has been corrected as a result of our quality control procedures. The original label was 'S41M/Y44G/G75Q/A78M'. Wed May 02 15:45:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser41met,tyr44gly,gly75gln,ala78met' Tue Jun 30 16:44:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser41Met;Tyr44Gly;Gly75Gln;Ala78Met]' ecolx Escherichia coli direct interaction direct interaction sycd-yopd-1 2 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 58-63 Region 58-63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction sica-2 5 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction