IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. PLoS genetics 2009 imex curation Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de Accepted 2017-JUN-20 AT 10:10 BST AT 10:10 BST by MGT PLoS genetics 2009 imex curation GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. PLoS genetics 2009 imex curation Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions caeel Caenorhabditis elegans confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de Accepted 2017-JUN-20 AT 10:10 BST AT 10:10 BST by MGT PLoS genetics 2009 imex curation GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. PLoS genetics 2009 imex curation Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down western blot western blot Immuno blot Immuno blot Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de Accepted 2017-JUN-20 AT 10:10 BST AT 10:10 BST by MGT C.elegans cDNA PLoS genetics 2009 imex curation GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. PLoS genetics 2009 imex curation Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de Accepted 2017-JUN-20 AT 10:10 BST AT 10:10 BST by MGT PLoS genetics 2009 imex curation GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. PLoS genetics 2009 imex curation Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de Accepted 2017-JUN-20 AT 10:10 BST AT 10:10 BST by MGT PLoS genetics 2009 imex curation GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. PLoS genetics 2009 imex curation Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de Accepted 2017-JUN-20 AT 10:10 BST AT 10:10 BST by MGT C.elegans cDNA PLoS genetics 2009 imex curation GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. PLoS genetics 2009 imex curation Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de Accepted 2017-JUN-20 AT 10:10 BST AT 10:10 BST by MGT PLoS genetics 2009 imex curation GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. GLS-1, a novel P granule component, modulates a network of conserved RNA regulators to influence germ cell fate decisions. PLoS genetics 2009 imex curation Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de Accepted 2017-JUN-20 AT 10:10 BST AT 10:10 BST by MGT PLoS genetics 2009 imex curation q8i4m5-3 Germline survival defective-1 gls-1 C36B1.8 protein protein caeel Caenorhabditis elegans MANKKNHQQKKSTDGSTMNGNNATATAAATTQNSSQIGQNSNSSHSVTNDNTSSNNASTSTSSITSTTTTTTTVPSSQQSQSQNQYSHQRLSSTSSTSQQTGISKFPAKKAGHNELEKTSNTANSQSGAFKGTTNKDRPKEKEKNTHSGNRQSQVNHNHHHSNHVSGNQQNRKNKNRDHSNQSYRGGYTHNHNNYHSLENAKSSGFLSNSSLSSAGQISASSAPPVSTTPTAIPIFQESKIVQTDPPVEEAKKKKEKPKIKRDEEPMPYKSTDPKNMDSVMAFKEHDEWDKVEFMCELVSFLSPTDLRLLGNCIEGSVRCYNNQMRPVEKTSNCSDPTAGLPQFVCSPPPPPQQVYYFPGIADAALYQTRNAVNSVFVQQHPPGLPPLLGGMQNIMYPPDANFHHSTSCTTPSSSVSVANKDVNNVPVVLSSSVNGISNNIPSDRQQLDSKPNTARGSSGNINQSNTTSPEPEPGSNHISTTAANPAHPTSVTVPQSVPPVPQEPELFLKSVLDLTSYIYTLMAVCSSTNRKSAAKISDYVQNVILREKSQILERIPDELDKITVLQEIGKIVAAMTHHPAITLDDKMKYAALRDGLRAQIETLFRQYYTTQKQLEQSNLVVPSSQAVGDENDTDSDHESEEEFEPLSGVMGSRFESNPVQPSPSVPGTFFIIRFIGRQIEKNDNLFSLEIHWSDGDRTFAQRSRDQLKALQHRLLDEFGQQRSEKYLHQGCTTSYSSFDDDNKKLSASTSTMETFAPNGERIVPRLARDATPAQYVQYINELSDLPARMMLSAVICEEFNGTRAKTEDLLQETREASDGLIYSRWKNPRAKSPVRYFKRNATGSIDPIELPVNMQPFLYSNIPQTQVQTLFPSCSNCGGPHAPKHCEKQTLLSKKGDHRTRSDGEGSQQNGGTSSSNSYAPIHANLPHAVYIENPQAMLGSNHFNHHQQQHIIQNTIFHNGGQFRANGTYEPQIPIAYYHAQGTVQNSNNTGGVNGNSGGGNQNSNF EC250DCC301962EA gld3_caeel Defective in germ line development protein 3 gld-3 Germline development defective 3 T07F8.3 protein protein caeel Caenorhabditis elegans MGEQSHEKDHDEAHSYNPFVRSAVEYDADTRLQMAENAASARKLFVSSALKDIIVNPENFYHDFQQSAQMAEDANQRRQVSYNTKREAHIHQLKAQGLPLPSNIPMIEINPTRVTLNMEFESQYYSLMTSDNGDHENVASIMAETNTLIQLPDRSVGGTTPDPFAQQVTITGYFGDVDRARMLMRRNCHFTVFMALSKMKMPLHELQAHVRQNPIQNVEMSFVDAPEKNGIVTTYLRITAREKNQHELIEAAKRLNEILFRESPAPENNFTLHFTLSTYYVDQVLGSSSTAQLMPVIERETTTIISYPCYNNRNETRGNIYEIKVVGNIDNVLKARRYIMDLLPISMCFNIKNTDMAEPSRVSDRNIHMIIDESGIILKMTPSVYEPADLLSGEVPLNCASLRSKEFNIKKLYTAYQKVLSKKFDFIAPQPNDYDNSIWHHSLPANFLKNFNMPCRGELSDGSNGRRHRSSSIASSRSKHSYMSKGKQFSESSGGPSRSHTRVSSFSENSSTVPIMQFPTPHFAPPMLTPHHHMLKYVYLQQHQQAQTFLKGAAGLHPGTHIMFPPPIIVDGSFVSALPFADPVVFDGFPYVHGLFPVNEAEQHRNHRESSPSLRSTQEIRKPSRNMGNRPSSSTGSYYPSTTPRQRVYEQVREDDLRSHIGSRRTSVNGDDQNVESMHDQGYERQYPRQHQRLQKDDQQRWKTGSRGDIHSSRTINVHRDVRNSNEYDFHVGNSGPAKRSPSLEQVQLQMTHHLKLKSNDVDLDHEKLYMHESPHNDSDTTVSASGFGNDLMDGDFVQRFLSNANINESGRRPRTVSCFTEKDGQSARYIDSDGAYSVVDHASTHQSRSYDSFRKVGDNGVTKTILEPRARVEKDYGKISLEHKTKYSNEYGDEEKSAENDTSSLGSRQYRIDPMKLIASVRESSEQLPRIHERQFSDVLNEKEKEIADKSIESTVTQDLSLDETSTY CA1DB3F2D68143C8 gls1_caeel Germline survival defective-1 C36B1.8 gls-1 protein protein caeel Caenorhabditis elegans MRCLISYLFHSFLIFLKFIRSDVTALTLQEKRKKSRLTGILMKSMANKKNHQQKKSTDGSTMNGNNATATAAATTQNSSQIGQNSNSSHSVTNDNTSSNNASTSTSSITSTTTTTTTVPSSQQSQSQNQYSHQRLSSTSSTSQQTGISKFPAKKAGHNELEKTSNTANSQSGAFKGTTNKDRPKEKEKNTHSGNRQSQVNHNHHHSNHVSGNQQNRKNKNRDHSNQSYRGGYTHNHNNYHSLENAKSSGFLSNSSLSSAGQISASSAPPVSTTPTAIPIFQESKIVQTDPPVEEAKKKKEKPKIKRDEEPMPYKSTDPKNMDSVMAFKEHDEWDKVEFMCELVSFLSPTDLRLLGNCIEGSVRCYNNQMRPVEKTSNCSDPTAGLPQFVCSPPPPPQQVYYFPGIADAALYQTRNAVNSVFVQQHPPGLPPLLGGMQNIMYPPDANFHHSTSCTTPSSSVSVANKDVNNVPVVLSSSVNGISNNIPSDRQQLDSKPNTARGSSGNINQSNTTSPEPEPGSNHISTTAANPAHPTSVTVPQSVPPVPQEPELFLKSVLDLTSYIYTLMAVCSSTNRKSAAKISDYVQNVILREKSQILERIPDELDKITVLQEIGKIVAAMTHHPAITLDDKMKYAALRDGLRAQIETLFRQYYTTQKQLEQSNLVVPSSQAVGDENDTDSDHESEEEFEPLSGVMGSRFESNPVQPSPSVPGTFFIIRFIGRQIEKNDNLFSLEIHWSDGDRTFAQRSRDQLKALQHRLLDEFGQQRSEKYLHQGCTTSYSSFDDDNKKLSASTSTMETFAPNGERIVPRLARDATPAQYVQYINELSDLPARMMLSAVICEEFNGTRAKTEDLLQETREASDGLIYSRWKNPRAKSPVRYFKRNATGSIDPIELPVNMQPFLYSNIPQTQVQTLFPSCSNCGGPHAPKHCEKQTLLSKKGDHRTRSDGEGSQQNGGTSSSNSYAPIHANLPHAVYIENPQAMLGSNHFNHHQQQHIIQNTIFHNGGQFRANGTYEPQIPIAYYHAQGTVQNSNNTGGVNGNSGGGNQNSNF 56C1934E11A5BE6A q95zk7-2 Defective in germ line development protein 3 Germline development defective 3 T07F8.3 GLD-3S gld-3 protein protein caeel Caenorhabditis elegans MGEQSHEKDHDEAHSYNPFVRSAVEYDADTRLQMAENAASARKLFVSSALKDIIVNPENFYHDFQQSAQMAEDANQRRQVSYNTKREAHIHQLKAQGLPLPSNIPMIEINPTRVTLNMEFESQYYSLMTSDNGDHENVASIMAETNTLIQLPDRSVGGTTPDPFAQQVTITGYFGDVDRARMLMRRNCHFTVFMALSKMKMPLHELQAHVRQNPIQNVEMSFVDAPEKNGIVTTYLRITAREKNQHELIEAAKRLNEILFRESPAPENNFTLHFTLSTYYVDQVLGSSSTAQLMPVIERETTTIISYPCYNNRNETRGNIYEIKVVGNIDNVLKARRYIMDLLPISMCFNIKNTDMAEPSRVSDRNIHMIIDESGIILKMTPSVYEPADLLSGEVPLNCASLRSKEFNIKKLYTAYQKVLSKKFDFIAPQPNDYDNSIWHHSLPANFLKNFNMPCRGELSDGSNGRRHRSSSIASSRSKHSYMSKGKQFSESSGGPSRSHTRVSSFSENSSTVPIMQFPTPHFAPPMLTPHHHMLKYVYLQQHQQAQTFLKGAAGLHPGTHIMFPPPIIVDGSFGARYSSNIYPFSYIVPQNFNFLNGNFGHLKLKSNDVDLDHEKLYMHESPHNDSDTTVSASGFGNDLMDGDFVQRFLSNANINESGRRPRTVSCFTEKDGQSARYIDSDGAYSVVDHASTHQSRSYDSFRKVGDNGVTKTILEPRARVEKDYGKISLEHKTKYSNEYGDEEKSAENDTSSLGSRQYRIDPMKLIASVRESSEQLPRIHERQFSDVLNEKEKEIADKSIESTVTQDLSLDETSTY E4AE8C8DB0F51799 q95zk7-1 Defective in germ line development protein 3 T07F8.3 GLD-3L Germline development defective 3 gld-3 protein protein caeel Caenorhabditis elegans MGEQSHEKDHDEAHSYNPFVRSAVEYDADTRLQMAENAASARKLFVSSALKDIIVNPENFYHDFQQSAQMAEDANQRRQVSYNTKREAHIHQLKAQGLPLPSNIPMIEINPTRVTLNMEFESQYYSLMTSDNGDHENVASIMAETNTLIQLPDRSVGGTTPDPFAQQVTITGYFGDVDRARMLMRRNCHFTVFMALSKMKMPLHELQAHVRQNPIQNVEMSFVDAPEKNGIVTTYLRITAREKNQHELIEAAKRLNEILFRESPAPENNFTLHFTLSTYYVDQVLGSSSTAQLMPVIERETTTIISYPCYNNRNETRGNIYEIKVVGNIDNVLKARRYIMDLLPISMCFNIKNTDMAEPSRVSDRNIHMIIDESGIILKMTPSVYEPADLLSGEVPLNCASLRSKEFNIKKLYTAYQKVLSKKFDFIAPQPNDYDNSIWHHSLPANFLKNFNMPCRGELSDGSNGRRHRSSSIASSRSKHSYMSKGKQFSESSGGPSRSHTRVSSFSENSSTVPIMQFPTPHFAPPMLTPHHHMLKYVYLQQHQQAQTFLKGAAGLHPGTHIMFPPPIIVDGSFVSALPFADPVVFDGFPYVHGLFPVNEAEQHRNHRESSPSLRSTQEIRKPSRNMGNRPSSSTGSYYPSTTPRQRVYEQVREDDLRSHIGSRRTSVNGDDQNVESMHDQGYERQYPRQHQRLQKDDQQRWKTGSRGDIHSSRTINVHRDVRNSNEYDFHVGNSGPAKRSPSLEQVQLQMTHHLKLKSNDVDLDHEKLYMHESPHNDSDTTVSASGFGNDLMDGDFVQRFLSNANINESGRRPRTVSCFTEKDGQSARYIDSDGAYSVVDHASTHQSRSYDSFRKVGDNGVTKTILEPRARVEKDYGKISLEHKTKYSNEYGDEEKSAENDTSSLGSRQYRIDPMKLIASVRESSEQLPRIHERQFSDVLNEKEKEIADKSIESTVTQDLSLDETSTY CA1DB3F2D68143C8 fbf2_caeel Fem-3 mRNA-binding factor 2 fbf-2 F21H12.5 protein protein caeel Caenorhabditis elegans MDQSKMRRTNQFRKTSQKPPSTGIDSYPTPAQSPMAQHETPMWDFNSLNPYFSMLNMNDGINYARHQQNHIVTSRPPTPLTDLMSLRSFQSFPNVFMPVSRSRTSSFIQSDTDSSRLESDDFSQNVRCFSADIDRSKSYGSSKHYHLKYSRPALSRNSRSFTRSNNVLPTWSLDSNGEMRSRLSLSEVLDSGDLMKFAVDKTGCQFLEKAVKGSLTSYQKFQLFEQVIGRKDDFLKLSTNIFGNYLVQSVIGISLATNDDGYTKRQEKLKNFISSQMTDMCLDKFACRVIQSSLQNMDLSLACKLVQALPRDARLIAICVDQNANHVIQKVVAVIPLKNWEFIVDFVATPEHLRQICSDKYGCRVVQTIIEKLTADSMNVDLTSAAQNLRERALQRLMTSVTNRCQELATNEYANYIIQHIVSNDDLAVYRECIIEKCLMRNLLSLSQEKFASHVVEKAFLHAPLELLAEMMDEIFDGYIPHPDTGKDALDIMMFHQFGNYVVQCMLTICCDAVSGRRQTKEGGYDHAISFQDWLKKLHSRVTKERHRLSRFSSGKKMIETLANLRSTHPIYELQSSGHDSFKTDYFSTASEHDGPELEKNGIEEGSLMLEPRSNKSSVSVKFSSSGSHGDD mint Involved in the control of stem cells and sex determination in the C.elegans hermaphrodite germline. Binds specifically to the regulatory region of fem-3 3'-UTR and mediates the sperm/oocyte switch 6EDEE8F6791E4386 fbf1_caeel Fem-3 mRNA-binding factor 1 fbf-1 H12I13.4 protein protein caeel Caenorhabditis elegans MDQSKMRYTNQFRKTPQKPTSTEVGNHHTPAHSPMAQHETSMWNFNSLNPYFSMLNMNDGMNYARHQQNHIVTSRPPTPLTDLMSLRSFQSFPNVFMPVSRSRTSSFIQSDTDSSRLEPDDFSQNVRYCSTEIDRNNSSSKNDHLKYSRPALSRNSRSFTRSNNVLPTWSLDSNGEMRSRLSLSEVLDSGDLMKFAVDKTGCQFLEKAVKGSLTSYQKFQLFEQVIGRKDDFLKLSTNIFGNYFVQEIIGMSLTTYDDDNIKRQEKLKNFISSQMTDMCLDKFACRVIQSSLQNMDLSLACKLVQALPRDARLIAICVDQNANHVIQKVVAVIPLKNWEFIVDFVATPEHLRQICFDKYGCRVVQTIIEKLTADSINVDLTSAAQHLRERALQRLMTSVTNRCQELATNEYANYIIQHIVSNDDLAVYRECIIEKCLMRNLLSLSQEKFASHVVEKAFLHAPMELLAEMMDEIFDGYMPHPGTGKDALDIMMFHQFGNYVVQCMLTICCDAVSGRRQTKEGSYDHANSFQVWLKKLHSRVTKERHRLSRFSSGKKMIETLAHLRSTHPIYGLQSSGHESFKTDCFSTASEHDGLELEKNGIEEGNLRLMRTFSP 557B9D459F38C18C gld_3-gls_1-1 6 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supplementary materials gls_1-gld_3-2 6 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary materials gld_3-gls_1-3 3 9 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3B The interaction is not RNA-mediated GLS-1, but not GFP, was specifically pulled down by GLD-3L and not by MBP-coated beads alone (Figure 3B, lanes 4–6). gld_3-gls_1-4 5 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig. 3C In addition, we confirmed the existence of an in vivo GLS-1/GLD-3 complex by co-purifying each protein from wild-type worm extracts using protein-specific antibodies coupled to agarose beads (Figure 3C). gls_1-gld_3-1 5 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Fig. 3C In addition, we confirmed the existence of an in vivo GLS-1/GLD-3 complex by co-purifying each protein from wild-type worm extracts using protein-specific antibodies coupled to agarose beads (Figure 3C). gls_1-gld_3-3 7 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3A, 3D gld_3-gls_1-6 7 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait physical association physical association Fig. 3A, 3E gld_3-gls_1-7 7 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 3A gld_3-fbf_2-1 7 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig. 3A gls_1-gld_3-4 7 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Fig. 3A gld_3-gls_1-2 4 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig. 5F The N-terminal KH domain region of GLD-3 also bound very weakly to GLS-1. gld_3-gls_1-5 4 15 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 competitor competitor competitor prey prey purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association Fig. 5G fbf_1-gld_3-1 4 15 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig. 5G gld_3-gls_1-8 8 9 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q95ZK7-1:p.Gly327Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R Wed May 02 14:27:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly327arg' Tue Jun 30 19:26:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly327Arg' physical association physical association Fig. 7E Hence, we co-expressed both proteins in insect cells and consistently found that wild-type GLD-3 protein, but not GLD-3ax562, was able to associate with GLS-1 in co-immunoprecipitation experiments (Figure 7E). gld_3-gls_1-9 2 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 2A gld_3-gls_1-10 1 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 2D