DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. Nature 2009 imex curation Ho MC., Ménétret JF., Tsuruta H., Allen KN. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Ho MC., Ménétret JF., Tsuruta H., Allen KN. DIP original experiment: DIP-249895X Nature 2009 IMEx The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. Nature 2009 imex curation Ho MC., Ménétret JF., Tsuruta H., Allen KN. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Ho MC., Ménétret JF., Tsuruta H., Allen KN. DIP original experiment: DIP-249896X Nature 2009 IMEx The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. Nature 2009 imex curation Ho MC., Ménétret JF., Tsuruta H., Allen KN. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ho MC., Ménétret JF., Tsuruta H., Allen KN. DIP original experiment: DIP-249892X Nature 2009 IMEx The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. Nature 2009 imex curation Ho MC., Ménétret JF., Tsuruta H., Allen KN. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ho MC., Ménétret JF., Tsuruta H., Allen KN. DIP original experiment: DIP-249893X Nature 2009 IMEx The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. The origin of the electrostatic perturbation in acetoacetate decarboxylase. Nature 2009 imex curation Ho MC., Ménétret JF., Tsuruta H., Allen KN. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ho MC., Ménétret JF., Tsuruta H., Allen KN. DIP original experiment: DIP-249894X Nature 2009 IMEx The origin of the electrostatic perturbation in acetoacetate decarboxylase. adc_chrvo Probable acetoacetate decarboxylase adc CV_3520 protein protein chrvo Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) MKQQEVRQRAFAMPLTSPAFPPGPYRFVNREYMIITYRTDPAAIEAVLPEPLQMAEPVVRYEFIRMPDSTGFGDYSESGQVIPVTFRGERGSYTLAMFLDDQPPLAGGRELWGFPKKAGKPRLEVHQDTLVGSLDFGPVRIATGTMGYKYEALDRSALLASLAEPNFLLKIIPHVDGSPRICELVRYHTTDVAIKGAWSAPGSLELHPHALAPVAALPVLEVLSARHFVCDLTLDLGTVVFDYLRQ 3596958D9583E3E7 adc_cloab Acetoacetate decarboxylase adc CA_P0165 protein protein cloab Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) MLKDEVIKQISTPLTSPAFPRGPYKFHNREYFNIVYRTDMDALRKVVPEPLEIDEPLVRFEIMAMHDTSGLGCYTESGQAIPVSFNGVKGDYLHMMYLDNEPAIAVGRELSAYPKKLGYPKLFVDSDTLVGTLDYGKLRVATATMGYKHKALDANEAKDQICRPNYMLKIIPNYDGSPRICELINAKITDVTVHEAWTGPTRLQLFDHAMAPLNDLPVKEIVSSSHILADIILPRAEVIYDYLK CA6C1157644E13B0 caaad-1 2 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cvaad-1 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction caaad-2 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction caaad-3 5 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction caaad-4 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction