DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. DIP original experiment: DIP-260300X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. DIP original experiment: DIP-260297X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. DIP original experiment: DIP-260298X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. DIP original experiment: DIP-260299X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sung MT., Lai YT., Huang CY., Chou LY., Shih HW., Cheng WC., Wong CH., Ma C. DIP original experiment: DIP-260296X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of the membrane-bound bifunctional transglycosylase PBP1b from Escherichia coli. uvrb_ecoli UvrABC system protein B uvrB b0779 Excinuclease ABC subunit B JW0762 protein protein ecoli Escherichia coli (strain K12) MSKPFKLNSAFKPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIEQMRLSATKAMLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRVRGEVIDIFPAESDDIALRVELFDEEVERLSLFDPLTGQIVSTIPRFTIYPKTHYVTPRERIVQAMEEIKEELAARRKVLLENNKLLEEQRLTQRTQFDLEMMNELGYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVVDESHVTIPQIGGMYRGDRARKETLVEYGFRLPSALDNRPLKFEEFEALAPQTIYVSATPGNYELEKSGGDVVDQVVRPTGLLDPIIEVRPVATQVDDLLSEIRQRAAINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIGRAARNVNGKAILYGDKITPSMAKAIGETERRREKQQKYNEEHGITPQGLNKKVVDILALGQNIAKTKAKGRGKSRPIVEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAAQIRDQLHQLRELFIAAS DIP protein P0A8F8 original sequence version: 87 DIP protein P0A8F8 original sequence version: 52 DIP protein P0A8F8 original sequence version: 88 DIP protein P0A8F8 original sequence version: 46 DIP protein P0A8F8 original sequence version: null 2F172045344FDAD7 ftsn_ecoli Cell division protein FtsN ftsN msgA b3933 JW3904 protein protein ecoli Escherichia coli (strain K12) MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLVTFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSAGGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLAEQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASSQQPYQDLLQTPAHTTAQSKPQQAAPVARAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG DIP protein P29131 original sequence version: 125 21CEA5771FF3FB66 uvra_ecoli UvrABC system protein A uvrA dinE b4058 Excinuclease ABC subunit A JW4019 protein protein ecoli Escherichia coli (strain K12) MDKIEVRGARTHNLKNINLVIPRDKLIVVTGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEIHDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVLSQPEGKRLMLLAPIIKERKGEHTKTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVRDDLTQRLAESFETALELSGGTAVVADMDDPKAEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCDGLGVQQYFDPDRVIQNPELSLAGGAIRGWDRRNFYYFQMLKSLADHYKFDVEAPWGSLSANVHKVVLYGSGKENIEFKYMNDRGDTSIRRHPFEGVLHNMERRYKETESSAVREELAKFISNRPCASCEGTRLRREARHVYVENTPLPAISDMSIGHAMEFFNNLKLAGQRAKIAEKILKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIGLHQRDNERLLGTLIHLRDLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGEVVAEGPLEAIMAVPESLTGQYMSGKRKIEVPKKRVPANPEKVLKLTGARGNNLKDVTLTLPVGLFTCITGVSGSGKSTLINDTLFPIAQRQLNGATIAEPAPYRDIQGLEHFDKVIDIDQSPIGRTPRSNPATYTGVFTPVRELFAGVPESRARGYTPGRFSFNVRGGRCEACQGDGVIKVEMHFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFFDAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYILDEPTTGLHFADIQQLLDVLHKLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECEASHTARFLKPML DIP protein P0A698 original sequence version: 81 DIP protein P0A698 original sequence version: 82 DIP protein P0A698 original sequence version: 41 DIP protein P0A698 original sequence version: null D61AAEB6514B860C mlta_ecoli Membrane-bound lytic murein transglycosylase A mltA mlt b2813 JW2784 ygdM Murein hydrolase A Mlt38 protein protein ecoli Escherichia coli (strain K12) MKGRWVKYLLMGTVVAMLAACSSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAPGAGNVFSG DIP protein P0A935 original sequence version: 81 5ECBB92C1E8D5969 pbpb_ecoli Penicillin-binding protein 1B mrcB pbpF ponB b0149 JW0145 Murein polymerase protein protein ecoli Escherichia coli (strain K12) MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGMRILPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN DIP protein P02919 original sequence version: 122 DIP protein P02919 original sequence version: 161 CED0A19FAC73961E ftsi_ecoli Peptidoglycan D,D-transpeptidase FtsI ftsI pbpB b0084 Penicillin-binding protein 3 JW0082 Essential cell division protein FtsI Murein transpeptidase Peptidoglycan synthase FtsI protein protein ecoli Escherichia coli (strain K12) MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS DIP protein P0AD68 original sequence version: 84 This sequence has been withdrawn from Uniprot. C89A403D5980B2CD mrcb-uvra-1 3 8 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association mrcb-mlta-1 5 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role bait bait Region 114-191 Region 114-191 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 114-191 Region 114-191 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association mrcb-ftsi-1 4 11 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association uvrb-uvra-1 2 8 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association mrcb-ftsn-2 1 7 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association