DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Cayrol C., Girard JP. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Cayrol C., Girard JP. DIP original experiment: DIP-260294X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Cayrol C., Girard JP. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Cayrol C., Girard JP. DIP original experiment: DIP-260291X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Cayrol C., Girard JP. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cayrol C., Girard JP. DIP original experiment: DIP-260293X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Cayrol C., Girard JP. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Cayrol C., Girard JP. DIP original experiment: DIP-260292X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH DIP protein P29466 original sequence version: 155 DIP protein P29466-1 original sequence version: 169 DIP protein P29466 original sequence version: 169 DIP protein P29466 original sequence version: 163 DIP protein P29466 original sequence version: 101 DIP protein P29466 original sequence version: 160 DIP protein P29466 original sequence version: 184 ABF33CF33CC71584 il1b_human Interleukin-1 beta IL1B IL1F2 Catabolin protein protein human Homo sapiens Human MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS DIP protein P01584 original sequence version: 172 DIP protein P01584 original sequence version: 175 DIP protein P01584 original sequence version: 156 9BF73C3673C6FD66 il33_human Interleukin-33 Interleukin-1 family member 11 Nuclear factor from high endothelial venules IL33 C9orf26 IL1F11 NFHEV protein protein human Homo sapiens Human MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET DIP protein O95760 original sequence version: 98 7C158069196EF636 o95760-1 Interleukin-33 IL33 C9orf26 IL1F11 NFHEV Interleukin-1 family member 11 Nuclear factor from high endothelial venules protein protein human Homo sapiens Human MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET DIP protein O95760-1 original sequence version: 98 q01638-2 Interleukin-1 receptor-like 1 IL1RL1 DER4 Protein ST2 ST2 T1 ST2S protein protein human Homo sapiens Human MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF DIP protein Q01638-2 original sequence version: 142 F91C46FE2D7FEAD1 casp1-il33-1 2 8 enzyme target enzyme target substrate substrate unspecified role unspecified role O95760-1:p.Asp178Ala D178A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D178A'. Wed May 02 15:41:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp178ala' Tue Jun 30 19:24:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp178Ala' in vitro In vitro 5 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage il1rl1-il33-1 1 7 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse Mus musculus Mouse physical association physical association casp1-il1b-1 4 6 enzyme target enzyme target substrate substrate unspecified role unspecified role in vitro In vitro 5 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage il1rl1-il33-2 3 9 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse Mus musculus Mouse 8 unspecified role unspecified role prey prey Region 112-270 Region 112-270 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction